RetrogeneDB ID:
retro_ecab_874
Organism:
Horse ( Equus_caballus )
Location:
6:27557544-27557811 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
70.79 %
Coverage:
76.72 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
EFCAB2
Parental gene aliases:
No gene alias available
Parental gene description:
EF-hand calcium binding domain 2 [Source:HGNC Symbol;Acc:28166]

Genomic region (view in browser)





>retro_ecab_874
ATGGAGAAGATCAGAAAAATCTTTAGTTCATTAGGATGCTACTCTAGTCAAGGAGAGCTG
CAGGATCTGATTGCAGAGGGAGAGGAAGAAGAACCCACTGGATACGTTTGATTCAAAAAA
TTTCTTCCAGTGATGACTGAAGCACTGCTAGAAAACGGACAGAGACCAATTCCAGAGGAT
ATCCTTCTTCGATTTTTTGAGGTCTTGGAGCCAGCAAAATGTGGGTCTCTTTCTAAGGAA
GAACTGAGCAAGTACATGACTGAAGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.45
SRP021940_embryo 0.48
SRP021940_placental_villous 0.72
SRP021940_synovial_membrane 0.36
SRP021940_testis 0.71

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VREIGTIIRSLGCCPSEGELHDLIAEVEEEEPTGYIRYEKFLPVMTQVLLERRYRPIPEDILLRAFEVLDPAKRGFLSKEELIKYMTEE
...I..I..SLGC..S.GEL.DLIAE.EEEEPTGY....KFLPVMT..LLE...RPIPEDILLR.FEVL.PAK.G.LSKEEL.KYMTEE
Retrocopy
MEKIRKIFSSLGCYSSQGELQDLIAEGEEEEPTGYV*FKKFLPVMTEALLENGQRPIPEDILLRFFEVLEPAKCGSLSKEELSKYMTEE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide