RetrogeneDB ID:
retro_ecab_876
Organism:
Horse ( Equus_caballus )
Location:
6:30891698-30892223 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.58 %
Coverage:
60.41 %
Frameshifts:
6
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS2
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S2 [Source:HGNC Symbol;Acc:10404]

Genomic region (view in browser)





>retro_ecab_876
CGTGCTGACCAACAGAACAGGATCAGGGCATTTGTCGCCATTGGGGAATACAAGGGACGT
GTCAGTATGGGGGTTAAGTGCTCCAAGGCGGTAGCCACTGCCATTTGTGGGGCCGTTCTT
CTGGCTAAGCTCTCTCTAGTCCCAGTGCAGTGAGGCTGCTGGGGAAACAAGATCAGCAAG
CTCCACACCATCCCTTGCAAGGCGACTGGCTGATGTGGTTCTGTGCAGGCGCACCTCAGC
CCCGCCCCCGGGGCACTGGTGTTGTCGCAGCCCTGTGCCCAAGAAGCTACTGCTGCTGAC
TCGCATTGACACCTGTTACACCTCGGCCAGGGCTGCACTGCTACCTGGGCAGCTTTGCCA
AGGCCACTTTTGATGCCATTTCTAAGACCTACGGCTTTCTCACCCCCAACCCCTGGAAAG
AGACCGTGTTCACCAAGTCCCTGATCAGGAATTCACTGGCCATTTTGTAAAGACCCACCT
AGAGTTTCCGTGCAGAAGACCCAGGCTCCAGCTGTGGCCAGCACA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.17
SRP021940_cerebellum 0.35
SRP021940_embryo 0.74
SRP021940_placental_villous 0.27
SRP021940_synovial_membrane 0.49
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPA-PRGTGIVSA-PVPKKLL
RA.Q..R..AFVAIG.Y.G.V..GVKCSK.VATAI.GA..LAKLS.VPV..G.WGNKI.K.HT.PCK.TG.CGSV...L.PA.PRGTG.V.A.PVPKKLL
Retrocopy
RADQQNRIRAFVAIGEYKGRVSMGVKCSKAVATAICGAVLLAKLSLVPVQ*GCWGNKISKLHTIPCKATG*CGSVQAHLSPA/PRGTGVVAA/PVPKKLL


Parental protein
MMAGIDDCYTSAR-GCTAT-LGNFAKATFDAISKTYSYLTPDLWKETVFTKS-PYQEFTDHLVKNH-TRVSVQRTQAPAVATT
....ID.CYTSAR.GCTAT.LG.FAKATFDAISKTY..LTP..WKETVFTKS.P.QEFT.H.VK.H..RVSVQ.TQAPAVA.T
Retrocopy
LLTRIDTCYTSAR/GCTAT/LGSFAKATFDAISKTYGFLTPNPWKETVFTKS/PDQEFTGHFVKTH/PRVSVQKTQAPAVAST


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide