RetrogeneDB ID:
retro_ecab_886
Organism:
Horse ( Equus_caballus )
Location:
6:66204470-66205286 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.09 %
Coverage:
54.08 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Glutamate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:F6V4L4]

Genomic region (view in browser)





>retro_ecab_886
CAAGTTTCTTATATGAGCATTTTAGGAATTAAACCGGAGTTTGTAGATAATACTTTGTTA
TTCAGGGATTTGGCAATGTGGGCCTGTACCCTATGAGATCATTACATCATATTGGTGCTA
AATGTCTTGGTGTTGGTGAATCTAGTGGGAGCATGTGGAATTTAGATGGCATTGACTCAA
AGAAGCTAGAAGACTTCAAATTGCAATGTGGATCAATCCTGGGTTTCCCCAAGGCAAAGC
CCTAGGAAGGAAATGTCTTCTAAGCAGACTGTGACATACTAATCCCTGCTGTCAATGAGA
AGCAGTTGACCAAATCCGGGGCATCCAGAGTCAAAAGCCAGGATTGTTGCTGAAGCTGCC
AAAGGACCGACAACTCTAGAAGCTGATGAGATTTTTTTGGAGAGGAACGTTATGGTTATT
CCTGATCTCCTCTTAAATGCTGGTACAATGACAGTATCTTAGTTGGAGTGGCTGAAGAAC
ATAAATCATGTCAGCTATGGCCATTTGAGCTTCAAGTATGAAAGAGATTCTAACTACCAC
TTCCTCATGTCTATTCACAGGAGTTTAGAAAGAAAATTTGGAAACCACCATGGAACTATT
TCCGTCGTAACCACAGCAGGGTTCCAAAACAGAATATCAGGTACATCTGAGAAAGACATC
GTGCATTCTGGCTTACCTTACACTATGGAGTTTTCTGCCTGGCAAATCATGCCCAGCACC
ACAAAGTATAACCTAGGATTGGATCTGAGAACAGCTGCCTATGTCAACAGCATTTAGAAA
GTCTTCAGGGTGTACAAGGAAGCTGGTTTGACCTTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 2.14

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EASYMSILGMTPGFGDKT-FVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAAS
..SYMSILG..P.F.D.T.FV.QGFGNVGL..MR.LH..GAKC..VGES.GS.WN.DGID.K.LEDFKLQ.GSILGFPKAKP.EG....ADCDILIPA..
Retrocopy
QVSYMSILGIKPEFVDNT/FVIQGFGNVGLYPMRSLHHIGAKCLGVGESSGSMWNLDGIDSKKLEDFKLQCGSILGFPKAKP*EGNVF*ADCDILIPAVN


Parental protein
EKQLTKSNAPRVK-AKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGG
EKQLTKS.A.RVK.A.I.AE.A.GPTT.EAD.IFLERN.MVIPDL.LNAG..TVS..EWLKN.NHVSYG.L.FKYERDSNYH.LMS...SLERKFG.H.G
Retrocopy
EKQLTKSGASRVK\ARIVAEAAKGPTTLEADEIFLERNVMVIPDLLLNAGTMTVS*LEWLKNINHVSYGHLSFKYERDSNYHFLMSIHRSLERKFGNHHG


Parental protein
TIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTF
TI..V.TA.FQ.RISG.SEKDIVHSGL.YTME.SA.QIM....KYNLGLDLRTAAYVN.I.KVF.VY.EAG.TF
Retrocopy
TISVVTTAGFQNRISGTSEKDIVHSGLPYTMEFSAWQIMPSTTKYNLGLDLRTAAYVNSI*KVFRVYKEAGLTF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide