RetrogeneDB ID:
retro_ecab_889
Organism:
Horse ( Equus_caballus )
Location:
6:74240950-74241941 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.4 %
Coverage:
83.76 %
Frameshifts:
4
Stop codons:
4


Parental gene:
Parental gene symbol:
CYTH2
Parental gene aliases:
No gene alias available
Parental gene description:
cytohesin 2 [Source:HGNC Symbol;Acc:9502]

Genomic region (view in browser)





>retro_ecab_889
AAGAACTTCAACATGGACCCCAAGAAGGGGATCCACTTCTTGCTGGATAATGAACTTCTC
CAGAAGATACCCAACGAGCTTGCCCCTTTCCTTTACAACGGCAAGGGCCTGAACAAGACA
GCCTTGGGGATTACGTAGGGGAGAGGGAAGAGCTGAACCTGGCAATGCTCCACGATTTTG
TGAATCTGCGTGAGTTTACCGACCTCAATTTGGTGCAGGCCCTCAGGCAATTTCTATGGA
GCTTCCCGCCTCCCTGGAGAGGCCCAGGAGATTGACTGGATGATAGAAGCCTTCGCCCAG
CCATACTGTCTGTGCAGCCCTGGGGTTTTCCAGTCCACAAGCATGTCCTACGTGCTGTCT
TTCACCATGATCATGCTGAGCACCACCAGCCTTTACAATCCCAACGTCTGGGACAAGCTG
GGCCTGGAGCACTTTGTGGCCATGAACCAGGGCAATCAACAAGGGCAGGACCAGCTTGAG
GAGCTGCTCAGGAACCTCTAGGACAGAACCTGAAATGAGCCCTTCCAGATTCCTGAGGAT
GATGGAAATGATCCGACCCACAGCTTCTTTAACCCAGACCGGGAAGGCTGGCTCCTTAAG
CTGGGAGGGCTCTGCGTGAAGACATGGAAGCTGCTCTGGGTTATCCTTACCCACAACTGC
CTCTACTATTTTGAGTGCATGATGGACAAGGAGCCAGAGGAATCATACTCCTGGAGAATC
TGAGCAGCCTAGAGCTGGATGACCCCCAGAAACCTTCCTGCTTTGAGCTTTACATTCCCC
AAAACGAGGGATAGCTCATCAAAGCCAGGAAAATGGAGGCAGATGGCTGGGTGGTTGAGG
AGAACCACATGGTGTACAGGTCTCAGCCCCATAGGAGGAGAAGGACAAATGGAGCAAGTC
CATCCAGGCAGCAGTGACTGTGGACCCCATCTATGAGATGCTGGTGGCAAGGGAGAAGGG
GATTTCTGTCAAGAAGCAGCAGGAACAGCCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.29
SRP021940_placental_villous 0.45
SRP021940_synovial_membrane 0.21
SRP021940_testis 2.2

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIG-DYLGEREVLNLAVLHAFVNLHEFTVSNLVQALRQFLWSF-RLPGEAQKIDRMMEAF
K.FNMDPKKGI.FL..NELLQ..P.E.A.FLY.G.GLNKTA.G.DY.GERE.LNLA.LH.FVNL.EFT..NLVQALRQFLWSF.RLPGEAQ.ID.M.EAF
Retrocopy
KNFNMDPKKGIHFLLDNELLQKIPNELAPFLYNGKGLNKTALG/DYVGEREELNLAMLHDFVNLREFTDLNLVQALRQFLWSF\RLPGEAQEIDWMIEAF


Parental protein
AQRYCLCNPGVFQSTDTCYVLSFAVIMLNT-SLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWL
AQ.YCLC.PGVFQST...YVLSF..IML.T.SL.NPNV.DK.GLE.FVAMN.G...G.D..EELLRNL.D...NEPF.IPEDDGND.TH.FFNPDREGWL
Retrocopy
AQPYCLCSPGVFQSTSMSYVLSFTMIMLSTTSLYNPNVWDKLGLEHFVAMNQGNQQGQDQLEELLRNL*DRT*NEPFQIPEDDGNDPTHSFFNPDREGWL


Parental protein
LKLGGR-VKTWKRRWFILTDNCLYYFEYTTDKEP-RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYR-ISAPTQEEK
LKLGG..VKTWK..W.ILT.NCLYYFE...DKEP.RGII.LENLS..E.DDP.KP.CFELYIP.N.G.LIKA.K.EADG.VVE.NHMVYR..SAP..EEK
Retrocopy
LKLGGLCVKTWKLLWVILTHNCLYYFECMMDKEP/RGIILLENLSSLELDDPQKPSCFELYIPQNEG*LIKARKMEADGWVVEENHMVYR/VSAP-*EEK


Parental protein
DEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
D.W.KSIQAAV.VDP.YEML.AR.K.ISVKK.QEQP
Retrocopy
DKWSKSIQAAVTVDPIYEMLVAREKGISVKKQQEQP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide