RetrogeneDB ID:
retro_ecab_893
Organism:
Horse ( Equus_caballus )
Location:
6:2479323-2479969 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.76 %
Coverage:
69.43 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
TSR3
Parental gene aliases:
No gene alias available
Parental gene description:
TSR3, 20S rRNA accumulation, homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:14175]

Genomic region (view in browser)





>retro_ecab_893
CTGCTCAGCCACCTGAGTGCTCAGAATATGTCTCCTGCAGATAGGCGGCTGGTGACACAG
TCAGTGGTCCCGCCATAGACTGCTTGTGTGCCAGACAGGAGGAAATGCCATTTGGGAAGA
TGACGGAGAGCCTCTTGTGGCTGCTGACCCACTGGGTGGCTACTAACCCTGTGAAATATG
GCTGGCCCTGCAAACTGTCCACTGTAGAGGTTTTTGCTGCTACCTTCTGCATCTGGAGCA
TTTTGGACCACACAGTCATTTTGCTGCAGAAGTTTAGGTGGGGCAAGGGCTGGCTGGACC
TGAACCACCAGCTTCTGGACAAGTGTATGACCTGCAGCAGCCTATAGTGGGTGCTTGTGG
CAGAGAAGGAGCTCCTGGTAGTGCCAAGGGAGCCCCAGGAGGAGGAAGTCAATCCCTTTG
ATATGAATTCAGGGCAGGAGTTTGCAAACCCCAACACACCTGTGGGACACATCGGGTTGC
CCATGGACAGTGATAACAGTGACAACCATGAGTCTGAAGACTAAAGGCCCAATACCAAGG
ACAGAGGACACAACAGCAGTAGCTCAGAAGATGAGGAGAGGCAGGGAAAAAGGTAGAAGC
CAGTGCACCAACAGAGGTTTGGAAAGGAATCAAGAAACAGCAAAGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VLSPMASQYVSPADRQLVAQSGVA-VIDCSWARLDETPFGKMRGGHLRLLPHLVAANPVNYGRPCKLSCVEAFAATFCILGFSDLAVILL-RFKWGKGFL
.LS....Q..SPADR.LV.QS.V...IDC..AR..E.PFGKM....L.LL.H.VA.NPV.YG.PCKLS.VE.FAATFCI....D..VILL..F.WGKG.L
Retrocopy
LLSHLSAQNMSPADRRLVTQSVVP/AIDCLCARQEEMPFGKMTESLLWLLTHWVATNPVKYGWPCKLSTVEVFAATFCIWSILDHTVILLQKFRWGKGWL


Parental protein
DLNRQLLDKYAACSGPEEVLQAEQEFLVHAKEHPEEEEIDPFDVDSGREFANPNRPVAGTRLPMDSGDSDGDSEDEPEEHGPDPEQEG-SGSCSEKE-GT
DLN.QLLDK...CS....VL.AE.E.LV...E.P.EEE..PFD..SG.EFANPN.PV....LPMDS..SD.....E.E...P.....G...S.SE.E.G.
Retrocopy
DLNHQLLDKCMTCSSL*WVLVAEKELLVVPRE-PQEEEVNPFDMNSGQEFANPNTPVGHIGLPMDSDNSD---NHESED*RPNTKDRGHNSSSSEDE/GE


Parental protein
PERGAEARAPTEVWKGIKKRQR
.....EA.APTEVWKGIKK.QR
Retrocopy
AGKKVEASAPTEVWKGIKKQQR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide