RetrogeneDB ID:
retro_ecab_896
Organism:
Horse ( Equus_caballus )
Location:
6:8297248-8297559 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
66.67 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL37
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L37 [Source:HGNC Symbol;Acc:10347]

Genomic region (view in browser)





>retro_ecab_896
CTCTGGTCTCGGCTGCAGAAGCGAGCTGGCAAAGGGAACCTCATCATTGGGAAAGCATCT
AAGACACACAACTTGTGCTACCACTGTGGCTTTAAGACCTGCCACGTTCAGAAGTCAGCC
GGTGGCAAATGTGGCTACCCTGCCAAGAGGAAGAGAAAGTATACCTGGAGTGTCAAGGCT
AAAAGACAGATAGCGTCGGTACCAGTCGAATCAGGCACCGAAAGATTGTATCTCACAGAT
TCAGGCACGGATTCCGTAAAGGAAAAACACCTACACCCGAGACGGCAGCTGCTGCAGCAT
CCAGCTCATCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LWSRPQKRDDEGNVIVRKANKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRR-NTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVA
LWSR.QKR...GN.I..KA.KTH.LC..CG.K..H.QKS..GKCGYPAKRKRKY.WS.KAKR.....GT.R.RH.KIV..RFRHGFR.G.TP.P..AA.A
Retrocopy
LWSRLQKRAGKGNLIIGKASKTHNLCYHCGFKTCHVQKSAGGKCGYPAKRKRKYTWSVKAKRQ/DSVGTSRIRHRKIVSHRFRHGFRKGKTPTPETAAAA


Parental protein
ASSSS
ASSSS
Retrocopy
ASSSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide