RetrogeneDB ID:
retro_ecab_897
Organism:
Horse ( Equus_caballus )
Location:
6:29455836-29456612 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
83.46 %
Coverage:
64.43 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL3
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L3 [Source:HGNC Symbol;Acc:10332]

Genomic region (view in browser)





>retro_ecab_897
AAGCAACTGGAGAAGGACTTCAACAGCATGAAGAAGTACTGCCAGGTCATCTGTGTCATC
GCCCACACCCAGATGCTCCTGCTTCCTCTGCGCCAGAAGAAGCCCTATCTCAAGGAAATC
AAAGTGAATAGAGGCACTGTGGCTGAGAAATTGGACCAGCCCCATGGGAGGCTGGAGCAG
CAGTTTCCTGTGAACCAAGTTTTTGGGCAGTATGAGATGGTCGATGCCATCGGGGTGACC
AAAGGCAAAGGCTACAAAGGGGTCACTAGCTGCGGGCACACCAAGAAGCTGCCCTGCAAG
ACCCACCAACGGCTGTGCAAGGTTGCCTGTATTGGGGCATGGCATTCTGTCTGAGTGGCT
TTCTCTGTGGCACGGGCTGGGCAGAAAGGCTACCATCACTGCACCAAGATCAACAAGAAG
ATCTCCAAGATTGGCCAGGGCTACCTCATCAAGATGGCAAACTGATCAAGAACAGTGCCT
CCACTGATTGTGATCTGTCTGACAAGAGTATCAACCCTTTGGGTGGCTTTGTCCGCTTTG
GTGAAGTGACCAATGACTTTCTCATGCCGAAAGGCTGGGTGGTGGGAACCAAGAAGCGAG
TGCTCACCCTTTGCATGTCCTTGCTGGTGCAGACAAAGTGGTGGGCCCTGGAGAAGGTTG
ACCTCAAGTTCATCCATACCACCTCCAAGTTTGGCCATGGCCGCTTCTAGACAGTGGAGG
AGAAGAAAGCATTCATGGGATCACTTAAGAAAGACCGAATTGCAAAGGAAGAAGGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.05
SRP021940_embryo 0.19
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KQLEKDFSSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRK
KQLEKDF.SMKKYCQVI.VIAHTQM.LLPLRQKK..L.EI.VN.GTVAEKLD....RLEQQ.PVNQVFGQ.EM.D.IGVTKGKGYKGVTS..HTKKLP.K
Retrocopy
KQLEKDFNSMKKYCQVICVIAHTQMLLLPLRQKKPYLKEIKVNRGTVAEKLDQPHGRLEQQFPVNQVFGQYEMVDAIGVTKGKGYKGVTSCGHTKKLPCK


Parental protein
THRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIK-DGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKK
TH..L.KVACIGAWH...VAFSVARAGQKGYHH.T.INKKI.KIGQGYLIK.DGKLIKN.ASTD.DLSDKSINPLGGFV..GEVTNDF.M.KG.VVGTKK
Retrocopy
THQRLCKVACIGAWHSV*VAFSVARAGQKGYHHCTKINKKISKIGQGYLIK/DGKLIKNSASTDCDLSDKSINPLGGFVRFGEVTNDFLMPKGWVVGTKK


Parental protein
RVLTLRKSLLVQTKRRALEKVDLKFIDTTSKFGHGRFQTVEEKKAFMGPLKKDRIAKEEG
RVLTL..SLLVQTK..ALEKVDLKFI.TTSKFGHGRF.TVEEKKAFMG.LKKDRIAKEEG
Retrocopy
RVLTLCMSLLVQTKWWALEKVDLKFIHTTSKFGHGRF*TVEEKKAFMGSLKKDRIAKEEG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide