RetrogeneDB ID:
retro_ecab_899
Organism:
Horse ( Equus_caballus )
Location:
6:34976979-34978083 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
97.83 %
Coverage:
75.31 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
GMCL1
Parental gene aliases:
No gene alias available
Parental gene description:
germ cell-less, spermatogenesis associated 1 [Source:HGNC Symbol;Acc:23843]

Genomic region (view in browser)





>retro_ecab_899
GCCGGCCACGGCTTGTGTTACTGCCCGGGCAGCCGCAAGAGCAAGCGGAGCAGCGGGGCC
TTCTGCTACTGTCACCCCGACTCCGAGACAGACGAGGATGAGGAGGAAGGGGACGAGCAG
CAGCGGCTCCTCAACACCCCTCGAAGGAAAAAATTAAAGAGTACCTCCAAATATATTTAT
CAAACATTATTTTTGAATGGTGAAAATAGCGACATTAAGATTTGTGCTCCAGGAGAAGAA
TGGAGTTTACACAAAATATGTTTATGTCAATCTGGCTACTTTTCTAGTATGTTCAGTGGT
TCTTGGAAAGAATCCAGCATGAATATTATTGAACTGGAGATTCCTGATCAGAATATTGAT
ATAGAAGCACTGCAGGTTGCATTTGGGTCACTGTATCAAGATGATGTCTTAATAAAGCCC
AGTCGAGTTATTGCCATTTTGGCAGCAGCTTGTATGCTGCAGTTGGTTGGTTTAATACAG
CAGTGTGGTGAGACAATGAAGGAAACAATTAATGTGAAAACTGTGTGTGGCTATTACACA
TCAGCAGGGACCTATGGATTAGATTCTGTAAAGAAAAAGTGCCTTGAATGGCTTCTAAAC
AATTTGATGACTCATCAGAATGTTGAACTTTTTAAAGAACTCAGTATAAATGTCATGAAG
CAGCTTATTGGTTCATCTAACTTATTTGTGATGCAAGTGGAGATGGATGTATATACAGCT
CTTAAAAAGTGGATGTTTCTTCAACTTGTGCCTTCTTGGAATGGATCTTTAAAACAGCTT
TTGACTGAAACAGATGTCTGGTTTTCTAAGAGGAGAAAAGATTTTGAAGGTATGACCTTC
CTTGAAACTGAGCAGGGAAAACCATTTGTGTCAGTATTCAGACATTTAAGGTTACAGTAT
ATTATCAGTGATTTGGCCTCTGCGAGAATTATTGAACAAGATTCTCTAGTACCTTCAGAA
TGGTTATCTTCTGTTTATAAACAGCAGTGGCTTGCTATGCTCCGGGCAGAACAAGACAGT
GAGGTGGGGCCTCAAGAAATCAATAAAGAAGAATTAGAGGGAAATAGCATGAGGTGTGGT
AGAAAGCTTGCCAAAGATGGTGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.52
SRP021940_cerebellum 0.05
SRP021940_embryo 0.65
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.1
SRP021940_testis 12.05

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AGHGFCYCPGSRKRKRSSG-FCYCHPD-ETDEDEEEGDEQQRLLNTPRRKKLKSTSKYIYQTLFLNGENSDIKICALGEEWSLHKIYLCQSGYFSSMFSG
AGHG.CYCPGSRK.KRSSG.FCYCHPD.ETDEDEEEGDEQQRLLNTPRRKKLKSTSKYIYQTLFLNGENSDIKICA.GEEWSLHKI.LCQSGYFSSMFSG
Retrocopy
AGHGLCYCPGSRKSKRSSGAFCYCHPDSETDEDEEEGDEQQRLLNTPRRKKLKSTSKYIYQTLFLNGENSDIKICAPGEEWSLHKICLCQSGYFSSMFSG


Parental protein
SWKESSMNIIELEIPDQNIDIEALQVAFGSLYRDDVLIKPSRVIAILAAACMLQLDGLIQQCGETMKETINVKTVCGYYTSAGTYGLDSVKKKCLEWLLN
SWKESSMNIIELEIPDQNIDIEALQVAFGSLY.DDVLIKPSRVIAILAAACMLQL.GLIQQCGETMKETINVKTVCGYYTSAGTYGLDSVKKKCLEWLLN
Retrocopy
SWKESSMNIIELEIPDQNIDIEALQVAFGSLYQDDVLIKPSRVIAILAAACMLQLVGLIQQCGETMKETINVKTVCGYYTSAGTYGLDSVKKKCLEWLLN


Parental protein
NLMTHQNVELFKELSINVMKQLIGSSNLFVMQVEMDVYTALKKWMFLQLVPSWNGSLKQLLTETDVWFSKRRKDFEGMTFLETEQGKPFVSVFRHLRLQY
NLMTHQNVELFKELSINVMKQLIGSSNLFVMQVEMDVYTALKKWMFLQLVPSWNGSLKQLLTETDVWFSKRRKDFEGMTFLETEQGKPFVSVFRHLRLQY
Retrocopy
NLMTHQNVELFKELSINVMKQLIGSSNLFVMQVEMDVYTALKKWMFLQLVPSWNGSLKQLLTETDVWFSKRRKDFEGMTFLETEQGKPFVSVFRHLRLQY


Parental protein
IISDLASARIIEQDSLVPSEWLSSVYKQQWLAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGE
IISDLASARIIEQDSLVPSEWLSSVYKQQWLAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGE
Retrocopy
IISDLASARIIEQDSLVPSEWLSSVYKQQWLAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide