RetrogeneDB ID:
retro_ecab_902
Organism:
Horse ( Equus_caballus )
Location:
6:41975113-41975642 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
56.59 %
Coverage:
89.45 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_902
AATGAAGAAATTCTCCAAGAAATATCTGACTCAATAAGGAAATACAACCTAAGACCTATA
GGTATTCCAGAGGGAGAAGTGAGGGAGAAAGGAGCAAGAGAGCTTGTTCAAAGAAATAAT
ATGAGAACTTCCCAAACCTGGGGGAGGACTTGACTTACAAGTACATGAAGCCAATAGAAC
TCCTAATTAAGTCAATGCAAAAAGACCTCTACAAGGCATGCAACAGTAAAACTGACAAAA
GTTAAGGACAAAGAAAAAACATTAAGGGCAACAGGGCAAAAGGAAATAACCTACAAAGGA
ACCCCTATCAGGTTTTCAGCAGACTTCTCCGCAAACTTTACAAACTAGGAGAGAATGGAA
TAATATATTCAGAATAATAAAAAACAAAGACTTTCAGCCAAGAATAGTCTATTCAGCAAA
ACTAACCTTCAGATATGATGGAGAAATAAAAATTTTCCCAGATAAACAAAAGTTAAAGGA
GTTCATCGCAACTAGACATCTGTTACAAGAAATGATGAAGGAACACCTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.1
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SEDIFQEIYNPIRKRNIRIISIPT-GEERQNRRESLFKEIITENFLNLGK-GLEIQVKEANRTPNYINVERP-SPRHILVKLAKLVMKEYIMAEAARQKK
.E.I.QEI...IRK.N.R.I.IP..G.....R..........ENF.NLG..GL..QV.EANRTPN..N..RP.S.RH..VKL.K...KE.....A..QK.
Retrocopy
NEEILQEISDSIRKYNLRPIGIPE/GRSEGERSKRACSKK*YENFPNLGE/GLDLQVHEANRTPN*VNAKRP/STRHATVKLTKVKDKEKTL-RATGQKE


Parental protein
ITYKGSPIRLSADFS-QTVQTRREWNDIIKILKYKNYPPRILYPVKLSFRYGREIKAFQDKQKLREFITTRPPLQEMMKTAL
ITYKG.PIR.SADFS.QT.QTRREWN.I..I.K.K...PRI.Y..KL.FRY..EIK.F.DKQKL.EFI.TR..LQEMMK..L
Retrocopy
ITYKGTPIRFSADFS\QTLQTRREWNNIFRIIKNKDFQPRIVYSAKLTFRYDGEIKIFPDKQKLKEFIATRHLLQEMMKEHL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide