RetrogeneDB ID:
retro_ecab_903
Organism:
Horse ( Equus_caballus )
Location:
6:45624440-45624787 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.98 %
Coverage:
57.82 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
ZMYND19
Parental gene aliases:
No gene alias available
Parental gene description:
zinc finger, MYND-type containing 19 [Source:HGNC Symbol;Acc:21146]

Genomic region (view in browser)





>retro_ecab_903
GGGGGAGCGGCGTAGGGGAGGCAGTGCTGGGGCCTTTCAGGTGGTGCATCTCAACATCTG
GACAATATGCAGCTGGTGCGGCGGGGCTGGGGGCCCAAAGCAGAAGAGACCTCCAGAAAA
CAAAGGGAGCAAAGCTTATATTGGCTGGTGATTCATCAGCTTCCCATGGGCCCGACAGAA
GGGCAGTTCCCCACCTGGTACTATAACGCCAACCGGGACGTGGTGGGAGAGGAGAATTCC
TGCACCTACAACAGTGCCATTATGCTCCCTGAACAGTGACTGAGATGTAGCTCCGGGTGT
TCAACATCTGCGGGCGCTGCTAGATGGCCTGGTCCTGGGGCTCCCAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GGIAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTY-YECHYPPCTM
GG.A.G.Q...L........LDN.QLV..GW.PKAEETS.KQREQSLYWL.I.QLP..P.E.QFP....T.YYNAN.DVV..EENSCTY...CHY.P.T.
Retrocopy
GGAA*GRQCWGLSG-GASQHLDNMQLVRRGWGPKAEETSRKQREQSLYWLVIHQLPMGPTEGQFP----TWYYNANRDVV-GEENSCTY/QQCHYAP*TV


Parental protein
IEKQLREFNICGRCQVARYCGSQ
.E..LR.FNICGRC..A...GSQ
Retrocopy
TEM*LRVFNICGRC*MAWSWGSQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide