RetrogeneDB ID:
retro_ecab_904
Organism:
Horse ( Equus_caballus )
Location:
6:48844391-48844742 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.93 %
Coverage:
73.91 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL29
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L29 [Source:HGNC Symbol;Acc:10331]

Genomic region (view in browser)





>retro_ecab_904
ATGGCCAAGTGCAAGAACCACACCAAGTACAACCTGTCCCCCAAATGACGCAGAAACGGC
ATTAGGGAACTGTGATCACAAAGATATGAATCTTAGGGTGAATGGACCCCAAGTTCCTGA
GGAACATGTGCTTTGCCAAGAGGCATAAGAAGGGCCTGAAGAAGATGCAAGCTGACAATG
CTGAGGCCATGAGTGCACATGCCGAGCCTCTGGAAGCCCACATAAAGCCCAAGGAGGTCA
AGGCCAAGATCCCAAGTGGTGTCGGCCTCAAGCTTGATGGACTTGCCTGCATTGCTCACC
CCAAGTCTGGGAAACATGTTCATGCCACGTCACCAAGATCTCAGGCTCTGC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAKSKNHTTHNQSRKWHRNGIKKPRSQRYES-LKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGGSRKLNRLTYI
MAK.KNHT..N.S.K..RNGI....SQRYES.L...DPKFLRNM.FAK.H.KKGLKKMQA.NA.AMSA.AE...A..KPKEVK.KIP.G...KL..L..I
Retrocopy
MAKCKNHTKYNLSPK*RRNGIREL*SQRYES/LG*MDPKFLRNMCFAKRH-KKGLKKMQADNAEAMSAHAEPLEAHIKPKEVKAKIPSGVGLKLDGLACI


Parental protein
AHPKLGKRARA-HIAK-GLRLC
AHPK.GK...A.H..K..LRLC
Retrocopy
AHPKSGKHVHA/HVTK/DLRLC


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide