RetrogeneDB ID:
retro_ecab_909
Organism:
Horse ( Equus_caballus )
Location:
6:58961750-58962054 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
88.24 %
Coverage:
59.41 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
TIMM17A
Parental gene aliases:
No gene alias available
Parental gene description:
translocase of inner mitochondrial membrane 17 homolog A (yeast) [Source:HGNC Symbol;Acc:17315]

Genomic region (view in browser)





>retro_ecab_909
GGGGAGCTTTCCATGATTGACTCCAGTATGGTTCAGGTCAGAGGGAAGGAAGACCCCCTG
GAACTCCATCACAAGTGGTGCCTTAACAGGAGCCATCCTGGCCAGGAGAAATGGACCAGT
GGCCATGGTCGGGTCAGCCACGATGGGTGGCATTCTCCTAGCTTTAACTGAAGGAGCTGG
TATCTTGTTGACAAGATTTGCCTCTGCACAATTTCCCAGTGGTCCTCAATTTGCTGAAAA
CCCCTCCCAGTTGCCTTCAGCCCAATTACCGTCCTCACCTTTTGGAGACTACCAACAATA
TCAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GLFSMIDCSMVQVRGKED-PWNSITSGALTGAILAARNGPVAMVGSAAVGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPAAQLPSSPFGDYRQ
G..SMID.SMVQVRGKED.PWNSITSGALTGAILA.RNGPVAMVGSA..GGILLAL.EGAGILLTRFASAQFP.GPQFAE.PSQLP.AQLPSSPFGDY.Q
Retrocopy
GELSMIDSSMVQVRGKED\PWNSITSGALTGAILARRNGPVAMVGSATMGGILLALTEGAGILLTRFASAQFPSGPQFAENPSQLPSAQLPSSPFGDYQQ


Parental protein
YQ
YQ
Retrocopy
YQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide