RetrogeneDB ID:
retro_ecab_91
Organism:
Horse ( Equus_caballus )
Location:
23:21876109-21876973 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.91 %
Coverage:
94.93 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
FAM122B
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 122B [Source:HGNC Symbol;Acc:30490]

Genomic region (view in browser)





>retro_ecab_91
ATGGCTCAGGAGAAGATGGAGCTAGACCTGGAGCTGCCTCCGGGGACGGGCGGGAGCCCG
GCGGAGGGCGGCGGCAATAGCGGCGGCGGGGGCCTCAGGAGGTCTAACAGCGCCCCCCTG
ATCCACGGCCTCAGTGACACTTCGCCGGTGTTCCAGGCCGAGGCGCCGAGCGCCAGGCGG
AACAGCACGACGTTCCCGAACCGCCACGGCCTGCTGCTACCGGCCTCCCCCGTCCGCATG
CACAGCAGCCGCTTGCACCAGATCAAACAGGAGGAGGGCATGGACTTGATCAACCGAGAG
ACGGTCCACGAGCGCGAGGTGCAGAACGCAATGCAGATAAGCCACTCCTGGGAGGAAAGT
TTCAGCCTGAGTGACAACGATGTGGAGAAATCCGCCTCCCCGAAGCGCATCGATTTCATT
CCGGTGTCACCAGCGCCGTCACCCACCCGGGGAATTGGGAAGCAGTGTTTTTCACCATCC
TTGCAAAGTTTTGTGAGTAGCAATGGATTGCCTCCAAGTCCTATTCCCAGCCCAACGACC
CGATTTTCTACCCGGAGAAGCCAGAGTCCCATTAATTGCATTAGACCAAGTGTTCTTGGA
CCATTGAAAAGAAAATGTGAAATGGAAACTGAGTATCAGCCAAAGAGATTTTTCCAGGGC
ATCACCACCATGCTTTCTTCTGACGTTGCACAGCTGTCAGATCCTGGTGTGTGTGTGTCT
TCAGATACCCTTGATGGAAACAGCAGCAGTGCCGGATCTTCTTGTAACTCACCAGCGAAA
GTCAGCACTACCACCGACTCTCCTGTGTCGCCTGCCCAAGCGGCCTCTCCGTTTATTCCC
GTAGATGAACTTTCATCTAAGTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 7.09
SRP021940_cerebellum 10.31
SRP021940_embryo 9.03
SRP021940_placental_villous 6.75
SRP021940_synovial_membrane 7.32
SRP021940_testis 6.11

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SDGATLRRSNSAPLIHGLSDLSQVFQPYTFRTRRNSTTIMSRHNLLLSSSPNRVPSSRLHQIKREEGMDMMNRETAHEREVQTAMQISQSWDESLSLSDS
S.G..LRRSNSAPLIHGLSD.S.VFQ......RRNSTT...RH.LLL..SP.R..SSRLHQIK.EEGMD..NRET.HEREVQ.AMQIS.SW.ES.SLSD.
Retrocopy
SGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPNRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQNAMQISHSWEESFSLSDN


Parental protein
DFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKQCFSPSLQMFVSNSEAATKVPASETRLWKEGRSQSPVKCIRPSVLGPLKRKGEMETESQPKRLFQGTTN
D....EK..SPKRIDF.PVSPAPSPTRG.GKQCFSPSLQ.FVS..........S.T......RSQSP..CIRPSVLGPLKRK.EMETE.QPKR.FQG.T.
Retrocopy
DV---EKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFSTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITT


Parental protein
MLSPEAAQLSDLSSC--SDILDGSSSSSGLSSDSLAKGSTTAESPVACSNSCSPFILMDDLSPK
MLS...AQLSD...C..SD.LDG.SSS.G.S..S.AK.STT..SPV......SPFI..D.LS.K
Retrocopy
MLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPVDELSSK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide