RetrogeneDB ID:
retro_ecab_912
Organism:
Horse ( Equus_caballus )
Location:
6:70013026-70014035 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.61 %
Coverage:
97.4 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
HNRNPH3
Parental gene aliases:
No gene alias available
Parental gene description:
heterogeneous nuclear ribonucleoprotein H3 (2H9) [Source:HGNC Symbol;Acc:5043]

Genomic region (view in browser)





>retro_ecab_912
ATGGATTGGGTTATGAAACATAATGGTCCAAATGACGTTAGTGATGGGACAGTACAATTT
GTGGACTGCCATTTGATTGCAGCAAAGAGGAAATAGTTCAGTTCTTTCAAGGGTTGGAAA
TCGTACCAAATGGGATAACGTTGATGATGCACTACAAGGGGAGGAGCACAGGGGAGGCCT
TCGTGCAGTTTGCTTCAAAGGAGATGGCAGAAAATGCTCCGGGGAAATCAAGGAAAGAAT
AGGGCACAGGTATGTTCAGATCTTCAAAAGCATCAGGAGTGAAATCAAAGGATTTTATGA
TCCACCAAGAAGATTGCTGGGCCAGCGACCGGGACCATATGATAGACCAATAGGAGGAAG
AGGGGGTTATTATGGAGCTGGGAGTGGAAGTATGTATGACAGAATGCGATCAAGAGGTGA
TGGGTATGATGGTGGTTATGGAGGTTTTGATGACTGTGGTGGCTATAATAATTATGGCTG
TGGAGATGATGGCTTCGATGACAGAATGAGAGATGGAAGAGGTATGGGAGGACATGGCTA
TGGTGGAGCTGGTGATGCCAGTTCAGGTTTCCATGGTGGTCATTTTGTACATATGAGAGG
ATTGCCTTTTCGTGCAACTGAAAATGATGTTGCTAGTTTTTTCTCACCACTAAATCCAAT
ATGAGTGCATGTTGGTATTGGAGCTGATGGCAGAGCAACAGGAGAAGCAGATGTAGAGTT
TGTGACACATGAAGATGCAGTAGCTGCCATATGTAAAGATAAGAATAACATGCAACATCG
ATACATTGAACTCTTCTGGAATTCGACTCCTGGAGGTGGCTCTGGAATGGGAGGTTCTGG
AATGGGAGGCTACGGCAGAGATGGAATAGATAATCAAGGAGGTTATGGCTCTGTTGGAAG
AATGGGAACGGGGAACTGTTACAGTGGAGGCTATGGCACTCCTGATGGCTTGAGTGGTTA
TGGCCCCGGTGGTGGAGGCAATGGAGGTTGTATGGGTAAGGACGGCGTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDWVMKHNGPNDASDGTVR-LRGLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGRSTGEAFVQFASKEIAENALGKH-KERIGHRYIEIFRSSRSEIKG
MDWVMKHNGPND.SDGTV....GLPF.CSKEEIVQFFQGLEIVPNGITL.M.Y.GRSTGEAFVQFASKE.AENA.GK..KERIGHRY..IF.S.RSEIKG
Retrocopy
MDWVMKHNGPNDVSDGTVQ/ICGLPFDCSKEEIVQFFQGLEIVPNGITLMMHYKGRSTGEAFVQFASKEMAENAPGKS/KERIGHRYVQIFKSIRSEIKG


Parental protein
FYDPPRRLLGQRPGPYDRPIGGRGGYYGAGRGSMYDRMRRGGDGYDGGYGGFDDYGGYNNYGYGNDGFDDRMRDGRGMGGHGYGGAGDASSGFHGGHFVH
FYDPPRRLLGQRPGPYDRPIGGRGGYYGAG.GSMYDRMR..GDGYDGGYGGFDD.GGYNNYG.G.DGFDDRMRDGRGMGGHGYGGAGDASSGFHGGHFVH
Retrocopy
FYDPPRRLLGQRPGPYDRPIGGRGGYYGAGSGSMYDRMRSRGDGYDGGYGGFDDCGGYNNYGCGDDGFDDRMRDGRGMGGHGYGGAGDASSGFHGGHFVH


Parental protein
MRGLPFRATENDIANFFSPLNPIRVHIDIGADGRATGEADVEFVTHEDAVAAMSKDKNNMQHRYIELFLNSTPGGGSGMGGSGMGGYGRDGMDNQGGYGS
MRGLPFRATEND.A.FFSPLNPI.VH..IGADGRATGEADVEFVTHEDAVAA..KDKNNMQHRYIELF.NSTPGGGSGMGGSGMGGYGRDG.DNQGGYGS
Retrocopy
MRGLPFRATENDVASFFSPLNPI*VHVGIGADGRATGEADVEFVTHEDAVAAICKDKNNMQHRYIELFWNSTPGGGSGMGGSGMGGYGRDGIDNQGGYGS


Parental protein
VGRMGMGNNYSGGYGTPDGLGGYGRGGGGSGGYYGQGGM
VGRMG.GN.YSGGYGTPDGL.GYG.GGGG.GG..G..G.
Retrocopy
VGRMGTGNCYSGGYGTPDGLSGYGPGGGGNGGCMGKDGV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide