RetrogeneDB ID:
retro_ecab_914
Organism:
Horse ( Equus_caballus )
Location:
6:73615764-73616082 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.81 %
Coverage:
58.89 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
AK3
Parental gene aliases:
No gene alias available
Parental gene description:
adenylate kinase 3 [Source:HGNC Symbol;Acc:17376]

Genomic region (view in browser)





>retro_ecab_914
ATTAAGCAATGCCTCACTGGTCACTGGATTCATCCAGCCAGTGCCAAGTCTACAAGATTG
AATTCAACCCTCCCAAAACTGTGGGTATTGATGATCCGACTGGATATCTTCTCGTTTAGC
ATGAGGATCATAGACCAGAGCTGGTTGTCAAGAGAGTGAAGGCTTACAAAGCTCAGACAG
AGCTGGTCCTGGAATACTACCAGAAAAAAAGCCATGTTGGAAACACTGTCTGGAACAGAA
ACCAACAAGATCTGACCCTGTGTATATGCTTTCCTACAAGCAGAAGTTCCACAAATAAGC
CAGAGGGTATCAGTTAGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IQHRLTARWIHPASGR-VYNMEFNPPKTLGVDDVTGEPLVQREDDKPETVVKRLKAYEAQTKPVLDYYQ-KKGVLETFSGTETNKIWPHVYAFLQTKVPQ
I...LT..WIHPAS...VY..EFNPPKT.G.DD.TG..LV..ED..PE.VVKR.KAY.AQT..VL.YYQ.KK..LET.SGTETNKI.P.VYAFLQ..VPQ
Retrocopy
IKQCLTGHWIHPASAK/VYKIEFNPPKTVGIDDPTGYLLV*HEDHRPELVVKRVKAYKAQTELVLEYYQ\KKAMLETLSGTETNKI*PCVYAFLQAEVPQ


Parental protein
VNQEASVT
..Q..SV.
Retrocopy
ISQRVSVS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide