RetrogeneDB ID:
retro_ecab_919
Organism:
Horse ( Equus_caballus )
Location:
7:18522089-18523450 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
96.49 %
Coverage:
90.26 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Glutamate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:F6V4L4]

Genomic region (view in browser)





>retro_ecab_919
GGCATCCTGCGGATCATCAAGCCTTGCAACCATGTGCTGAGCCTGTCCTTCCCCATCCGG
CGCGATGATGGCTCCTAGGAAGTCATCGAGGGCTACCGGGCCCAGCATAGCCAGCACCGC
ACGCCCTGCAAGGGAGGTATCCGTTACAGCACTGATGTGAGTGTAGACGAAGTGAAGGCT
TTGGCTTCTCTGATGACTTATAAGTGTGCAGTGGTTGATGTGCCATTTGGGGGTGCCAAA
GCTGGTGTTAAGATCAATCCCAAAAACTATACCGATAATGAATTGGAAAAGATCACGAGG
AGGTTTACCATGGAGCTGGCAAAGAAGGGCTTTATTGGTCCTGGCATTGATGTGCCTGCC
CAGACATGAGCACGGGCGAGCGGGAGATGTCCTGGATTGCTGACACCTATGCTAGCACCA
TAGGGCACTATGATATTAATGCCCACGCCTGTGTCACTGGGAAGCCCATCAGTCAGGGTG
GAATCTATGGGCGGATCTCTGCCACTGGCCGGGGTCTTTTCCATGGGATCGAGAACTTCA
TCAATGAAGCTTCTTACATGAGCATTCTAGGAATGACGCCAGGGTTTGGAGATAAGACGT
TTGTCGTTCAGGGGTTTGGTAACGTGGGCCTGCACTCTATGAGATACTTACATCGTTTCG
GTGCTAAATGTATTGCTGTTGGTGAATCCGATGGGAGCATATGGAATCCAGATGGTATTG
ACCCAAAAGAACTGGAAGACTTCAAATTGCAACATGGATCCATCCTGGGCTTCCCCAAGG
CAAAGCCCTATGAAGGGAGCATCTTGGAGGCCGACTGTGACATCCTGATTCCTGCTGCCA
GGGAGAAGCAGCTGACCAAGTCCAATGCACCGAGAGTCAAAGCCAAGATCATTGCTGAAG
GTGCCAATGGACCGACAACTCCGGAAGCCGATAAGATTTCCCTGGAGAGAAACATTATGG
TTATTCCCGATCTCTACCTGAACACCGGAGGGGTGGTGTCCTACTTTGAGTGGCTGAAGA
ATCTCAATCACGTCAGCTACGGCCGCCTGACCATCAAATACGAAAGGGATTCCAACTACC
ACTTGCTGATGTCTGTTCAAGAGAGTTTGGAAGGAAAATTTGGAAAGCACGGTGGGACGA
TCCCCATTGTGCCCACGGCAGAGTTCCAAGACAGGATATCGGGTGCATCTGAGAAGGACA
TCGTGCACTCCTGCTTAGCTTACACCATGGAGCGCTCTGCCCAGCAAATCATGTGTCCGG
CCATGAAGTACAACCTGAGGTTGGACCTGAGGACGGCTGCCTACGTCAACGCCATCGAGA
AAGTCTTCAAGGTGTACAATGAAGCTGGTGTGACCTTCACA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 3.08
SRP021940_cerebellum 7.32
SRP021940_embryo 3.62
SRP021940_placental_villous 3.71
SRP021940_synovial_membrane 3.8
SRP021940_testis 0.47

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GILRIIK-ANHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITR
GILRIIK..NHVLSLSFPIRRDDGS.EVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITR
Retrocopy
GILRIIKPCNHVLSLSFPIRRDDGS*EVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITR


Parental protein
RFTMELAKKGFIGPGIDVPA-PDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGLFHGIENFINEASYMSILGMTPGFGDK
RFTMELAKKGFIGPGIDVPA.PDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGI.GRISATGRGLFHGIENFINEASYMSILGMTPGFGDK
Retrocopy
RFTMELAKKGFIGPGIDVPA/PDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIYGRISATGRGLFHGIENFINEASYMSILGMTPGFGDK


Parental protein
TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIA
TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAA.EKQLTKSNAPRVKAKIIA
Retrocopy
TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAAREKQLTKSNAPRVKAKIIA


Parental protein
EGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASE
EGANGPTTPEADKI.LERNIMVIPDLYLN.GGV.VSYFEWLKNLNHVSYGRLT.KYERDSNYHLLMSVQESLE.KFGKHGGTIPIVPTAEFQDRISGASE
Retrocopy
EGANGPTTPEADKISLERNIMVIPDLYLNTGGV-VSYFEWLKNLNHVSYGRLTIKYERDSNYHLLMSVQESLEGKFGKHGGTIPIVPTAEFQDRISGASE


Parental protein
KDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT
KDIVHS.LAYTMERSA.QIM..AMKYNL.LDLRTAAYVNAIEKVFKVYNEAGVTFT
Retrocopy
KDIVHSCLAYTMERSAQQIMCPAMKYNLRLDLRTAAYVNAIEKVFKVYNEAGVTFT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide