RetrogeneDB ID:
retro_ecab_927
Organism:
Horse ( Equus_caballus )
Location:
7:34358463-34360795 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.62 %
Coverage:
79.92 %
Frameshifts:
6
Stop codons:
4


Parental gene:
Parental gene symbol:
ZC3H7A
Parental gene aliases:
No gene alias available
Parental gene description:
zinc finger CCCH-type containing 7A [Source:HGNC Symbol;Acc:30959]

Genomic region (view in browser)





>retro_ecab_927
GCTTTGAACTGTTCTGTGGAAGATATTGAGCCAGATTTATTAACTCCAAGGCAAGAAGCA
GTTCCCATTGTTTCTATACCCGCATCCAGTTTTTCTCACCAAGTTGAAAGAGAGCTGGCC
TCAGTTCCTATTAAGCTCTTCAGTTCTATTTTGCCACTGCAAGTGGAAGAGAGCTCTCTG
CCATCTACAGTGTTGGCAAACGGAAGAAAAATTCCCTTCACTATGCCGGAAGCTTTTTTA
AATGATGGAGATATGGTCCTTGGAGATGAAATAGACGACCTCCTTGATTCTTCACCTGAA
ACTAATGAAGCTGTTATGCCATCAGCTTTAGTCAGAGGACCCCTTCCGACAGCCACTGTC
AGCCCTAGCATACCCTTTTCGGTGTCTTTGTTGGGCACCTTGCCCATTGGTGCGAGGTAT
GCCCCACCACCCTCCGTCTCAGCGCTGTATCCACCTCTGACTTCATCCTTAGAAGATTTC
TGTTCTTCTTTAAATTCATTTTCAATGAGTGAATCCAAACAAGATCTGTCCACCTCAACT
TCTAGAAAGGGAACATCGCTTAACAGCAGTAATTCTTCCCTTTGACTTATGAATGGACCA
GGCAGTCTGTTTGCTCCTGAGAGTTTCTTGGGGATTTCAAGTCACCCTAGAAATGACTTT
GGAAACTTTTTTGGAAGTGCAGTTACTAAACCACCTTCATCAGTGACCCCCAGACACCCC
CTTGAAGGAACCCACGAACTGAGACAAGCTTGCCAAATCTGTTCTGTAAAATCAGGCCCT
AAGCTAATGGATTTCACTTACCATGCTAATATAGATTATAAATGTAAGAAGGATATTTTA
ATTGGTAGAATAAAGAATGTTGAAGATAAATCACGGAAAAAAAATATGTCCATGACCAAC
AAAAACAAATTATGAAGGACCTTATTATATATACACAGATGTGGCTGCTGAGGAGGAATG
TAGGTATTCAGGCCACTGCACATTTGCTTACTGCCAAGAAGAGATAGATGTCTGGACACT
GGAGCAGAAAGGGGCCTTCAGTCGAGAGGCCTTCTTTGGTGGCAATGGAAAGGTCAACCC
TTACCATGTTCAAACTTCTCCAAAGAGCATCTGGGAGAATTTATATTCCTTTGTGAGAAA
TGTTTTGATCATAAGCCTAGAATGATAAGTAAAAGAAATAAACGTAATTCTACTTCTTGT
CCTCACCCAGATACAAAGCATGAGTTTGAAGACAATAAGTGCCTTGTCCACATTTTCCGA
GAGACAACAGTAAAATACTCCAAAATATGGTCTTTTCATGGTCAATGTCAGCTTGATTTA
TGTCGCCATGAGGTTTGATATGGCTGTTTAAGGGAAGATGAGTGCTTTTATGTGCATAGT
CTTGTAGAGTTGAAAGTCTGGATATTGCAGAATGAAACAGGTATCTCACATGATGCTATT
ACTCGAGAATCTAAACAGTATTGTCAGAATTGGAAGCAAATGTTCCTGGAGCTCAGGTAC
TTGACAATCAAATAATGCCTGGATGTCTTAATATGAACACAAAATTTTTGTGTTCTCAGT
GTCTGAGAAATGGTCAAGTCATCAAGCCAGACAAAAACAGAAAACATTGCAGTGCAAAAG
CAAGACATTTGTGGACCAAAGATCCTCATGCGATGAGAGTGATGTCTATTGAACGTAAGA
AGTAGATGAACATCCATCCTCTCCCCACAAAGAAACAAATGCCTTTACAGTTTGATCTGT
GCAATCATATTGCTTCTGGGAAAAAATGTCAATATGTTGAAAACTGTTCCTTTGCTCATA
GTCCTGAGGAGTGAGAAGGGTTGACTTACATGAAAGGCAATGGGACACAAGATATGGAGC
AGTTTTATGAACTCTGGCTAAAGAGTCAAAAAAAGATAAAGAGGTGATGATGTAGCCAGT
CAGTCAAATAAGGAAAACGGAAAACAGATTCACATGTCGACAGATTATGCCGAGGTCACC
GTGGACTTTCACTGCTGGATGTGCGGGAAGAACTGTAATAGTGAGAAGCAGTGGCAAGGC
CACATCTCCTCGGAGAAGCACGAAGAGAAGGTGTTCCACACGGAAGACGACCAGTACTGC
TGGCAGCACTGCTTTCCAACAGGGTATTTTAGTATTTGTGATAGGTATATGAATGGTACC
TGCATGGAAGGAAGCAGCTGTAAATTTGCACATGGAAATGCTGAACATCATGAATGGGAA
GAAAGAAGAGATACCCTAAAGATGAAGCTCAACAAAGCAAGAAAAGATCACTTAGTTGCC
CCAAATGATAATGACTTTGGAAAATATAGTTTTTTTGTTTAAAGATTTAAAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ALNCSVEDIEPDLLTPRQEAVPVVSIPASSFSHQVGSELASVPIMSLSSILPLQVDESSLPSTVLANGGKIPFTMPEAFLDDGDMVLGDEIDDLLDSAPE
ALNCSVEDIEPDLLTPRQEAVP.VSIPASSFSHQV..ELASVPI...SSILPLQV.ESSLPSTVLANG.KIPFTMPEAFL.DGDMVLGDEIDDLLDS.PE
Retrocopy
ALNCSVEDIEPDLLTPRQEAVPIVSIPASSFSHQVERELASVPIKLFSSILPLQVEESSLPSTVLANGRKIPFTMPEAFLNDGDMVLGDEIDDLLDSSPE


Parental protein
TNEAVMPSALVRGPLPTASVAPSIPFSASLLGTLPIGARYAPPPSFSELYPPLTSSLEDFCSSLNSFSMSESKRDLSTSTSREGTSLNSSNSALLLMNGP
TNEAVMPSALVRGPLPTA.V.PSIPFS.SLLGTLPIGARYAPPPS.S.LYPPLTSSLEDFCSSLNSFSMSESK.DLSTSTSR.GTSLNSSNS.L.LMNGP
Retrocopy
TNEAVMPSALVRGPLPTATVSPSIPFSVSLLGTLPIGARYAPPPSVSALYPPLTSSLEDFCSSLNSFSMSESKQDLSTSTSRKGTSLNSSNSSL*LMNGP


Parental protein
GSLFAPESFLGISSHPRNDFGNFFGSAVSKPPSSVTPRHPLEATHELRQACQICFVKSGPKLMDFTYHANLDHKCKKDILIGRIKNVEDKSWKKIRPRPT
GSLFAPESFLGISSHPRNDFGNFFGSAV.KPPSSVTPRHPLE.THELRQACQIC.VKSGPKLMDFTYHAN.D.KCKKDILIGRIKNVEDKS.........
Retrocopy
GSLFAPESFLGISSHPRNDFGNFFGSAVTKPPSSVTPRHPLEGTHELRQACQICSVKSGPKLMDFTYHANIDYKCKKDILIGRIKNVEDKSRXXXMSMTN


Parental protein
K-TNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDVWTLERKGAFSREAFFGGNGKVH-LTVFKLLQ-DHLGEFMFLCEKCFDHKPRMISKRNKDNST
K.TNYEGPYYI..DVAAEEECRYSGHCTFAYCQEEIDVWTLE.KGAFSREAFFGGNGKV..LT.FKLLQ..HLGEF.FLCEKCFDHKPRMISKRNK.NST
Retrocopy
K\TNYEGPYYIYTDVAAEEECRYSGHCTFAYCQEEIDVWTLEQKGAFSREAFFGGNGKVN\LTMFKLLQ\EHLGEFIFLCEKCFDHKPRMISKRNKRNST


Parental protein
SCSHPVTKHEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLREDECFYAHSLVELKVWILQNETGISHDAIAQESKRYWQN-LEGNAPG
SC.HP.TKHEFEDNKCLVHI.RETTVKYSKI.SFHGQCQLDLCRHEV.YGCLREDECFY.HSLVELKVWILQNETGISHDAI..ESK.Y.QN.LE.N.PG
Retrocopy
SCPHPDTKHEFEDNKCLVHIFRETTVKYSKIWSFHGQCQLDLCRHEV*YGCLREDECFYVHSLVELKVWILQNETGISHDAITRESKQYCQN/LEANVPG


Parental protein
AQVLGSQIMPGSLNMKIKFVCAQCLRNGQVIEPDKNRKYCSAKARHSWTKDRRAMRVMSIERKKWMNIRPLPTKKQMPLQFDLCNHIASGKKCQYVGNCS
AQVL..QIMPG.LNM..KF.C.QCLRNGQVI.PDKNRK.CSAKARH.WTKD..AMRVMSIERKK.MNI.PLPTKKQMPLQFDLCNHIASGKKCQYV.NCS
Retrocopy
AQVLDNQIMPGCLNMNTKFLCSQCLRNGQVIKPDKNRKHCSAKARHLWTKDPHAMRVMSIERKK*MNIHPLPTKKQMPLQFDLCNHIASGKKCQYVENCS


Parental protein
FAHSPEEREVWTYMKENGIQDMEQFYELWLKSQKNEK-SDDVASQSNKENGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTED
FAHSPEE.E..TYMK.NG.QDMEQFYELWLKSQK..K..DDVASQSNKENGKQIHM.TDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKH.EKVFHTED
Retrocopy
FAHSPEE*EGLTYMKGNGTQDMEQFYELWLKSQKKIK\GDDVASQSNKENGKQIHMSTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHEEKVFHTED


Parental protein
DQYCWQHRFPTGYFSICDRYMNGTCTEGSSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIAPNDNDFGKYS-FLFKDLN
DQYCWQH.FPTGYFSICDRYMNGTC.EGSSCKFAHGNAE.HEWEERRD.LKMKLNKARKDHL.APNDNDFGKYS.FLFKDLN
Retrocopy
DQYCWQHCFPTGYFSICDRYMNGTCMEGSSCKFAHGNAEHHEWEERRDTLKMKLNKARKDHLVAPNDNDFGKYS\FLFKDLN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide