RetrogeneDB ID:
retro_ecab_93
Organism:
Horse ( Equus_caballus )
Location:
18:34530152-34531541 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
98.7 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
eca-mir-703
Parental gene aliases:
EEF1A1, EF-1A, EF-Tu, EF1A, eEF1A-1
Parental gene description:
eca-mir-703 [Source:miRBase;Acc:MI0012753]

Genomic region (view in browser)





>retro_ecab_93
ATGGGGAAGGAAAAGACTCATATCAACATTGTCGTCATTGGACACGTCGATTCGGGCAAG
TCCACCACGACTGGCCACCTGATCTACAAGTGCGGTGGGATCGACAAAAGAACCATTGAG
AAATTCGAGAAGGAGGCTGCTGAGATGGGAAAGGGCTCCTTCAAGTACGCCTGGGTCTTG
GATAAACTGAAAGCTGAACGTGAGCGTTGTATCACCATTGATATCTCCCTGTGGAAATTC
GAGACCAGCAAGTATTATGTGACCATCATTGATGCCCCCGGACAGAGAGACTTCATCAAA
AACATGATTACAGGCACGTCTCAGGCTGACTGTGCTGTCCTGATTGTCGCTGCTGGTGTT
GGTGAATTTGAAGCAGGTATCTCCAAGAATGGGCAGACCCGTGAGCATGCCCTTCTGGCT
TACACACTGGGTGTGAAACAACTAATTGTTGGTGTTAACAAAATGGATTCCACTGAGCCA
CCCTACAGCCAGAAGAGATATGAGGAAATCGTTAAGGAAGTCAGCACCTACATTAAGAAA
ATTGGCTACAACCCAGACACAGTTGCATTTGTGCCAATTTCTGGTTGGAATGGTGACAAC
ATGCTGGAGCCAAGTGCTAATATGCCTTGGTTCAAGGGATGGAAAGTCACCCGTAAAGAT
GGCAATGCCAGTGGAACTACGCTGCTTGAAGCTCTGGATTGCATCCTGCCACCAACTCGT
CCAACTGATAAGCCCTTGCGTCTGCCCCTCCAGGACGTCTACAAAATTGATGGTATCGGT
ACTGTCCCTGTGGGCCGAGTGGAGACTGGTGTTTTGAAACCTGGCATGGTGGTCACCTTT
GCTCCAGTCAATGGTACAACTGAAGTAAAGTCTGTTGAAATGCATCATGAAGCTTTGAGC
AAAGCTCTTCCTGGGGACAACGTGGGCTTCAACGTCAAGAACGTGTCCGTCAAAGATGTT
CGCCGTGGCAATGTGGCTGGTGACAGCAAAAATGATCCACCAATGGAAGCAGCTGGCTTC
ACAGCTCAGGTGATTATCCTGAACCATCCAGGCCAAATCAGTGCTGGGTATGCACCTGTG
CTGGATTGTCACACAGCTCACATTGCTTGCAAGTTTGCTGAGCTGAAGGAGAAGATTGAT
CGTCGTTCTGGAAAGAAGCTGGAAGATGGCCCCAAATTCTTGAAATCTGGTGATGCTGCC
ATCGTTGATATGGTTCCTGGCAAGCCCATGTGTGTTGAGAGCTTTTCTGACTATCCTCCT
CTGGGCCGTTTTGCTGTTCGTGACATGAGACAGATGGTTGCTGTGGGTGTCATCAAAGCA
GTGGACAAGAAAGCAGCTGGAGCTGGCAAGGTCACCAAGTCTGCCCAGAAGGCTCAGAAG
GCTAAATGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 2.32
SRP021940_cerebellum 1.0
SRP021940_embryo 5.41
SRP021940_placental_villous 2.68
SRP021940_synovial_membrane 4.25
SRP021940_testis 1.19

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIK
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERER.ITIDISLWKFETSKYYVTIIDAPG.RDFIK
Retrocopy
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERCITIDISLWKFETSKYYVTIIDAPGQRDFIK


Parental protein
NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDN
NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDN
Retrocopy
NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDN


Parental protein
MLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
MLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKI.GIGTVPVGRVETGVLKPGMVVTFAPVN.TTEVKSVEMHHEALS
Retrocopy
MLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIDGIGTVPVGRVETGVLKPGMVVTFAPVNGTTEVKSVEMHHEALS


Parental protein
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA
.ALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA
Retrocopy
KALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA


Parental protein
IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQ.VAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
Retrocopy
IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQMVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide