RetrogeneDB ID:
retro_ecab_932
Organism:
Horse ( Equus_caballus )
Location:
7:60474282-60474595 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.67 %
Coverage:
53.89 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RHOC
Parental gene aliases:
No gene alias available
Parental gene description:
ras homolog family member C [Source:HGNC Symbol;Acc:669]

Genomic region (view in browser)





>retro_ecab_932
GAGAACCACATGGCTGACATTAAAGTGAATAGAAAGTAGGTGGTGATAGCTTTGTGGCGA
CACAGCTGGGCAGGAAGGTCGTGACCGGCTGAGACCCCTTTCCTACCCAGATACTGATGT
TATATTGATGTGTTTCTTCCTCAATAACTTTGGTAGTATTGAAACCCTCCCAGAAAAAAG
GAACATGGAAGGCAAGCATTTCTGTCCCAATGTGCACATCATCCTAGTTGGGAACAAGAA
TGATCTTCTGAAGGATGAGTGCATGAGGCAGGAGCTAGCCAAGATGAAGCAAGAGCCAAT
GAGACCTGATAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ENYIADIEVDGKQVELALW-DTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEP
EN..ADI.V..K.V..ALW.DTAGQE..DRLRPLSYPDTDVILMCF......S.E..PEK...E.KHFCPNV.IILVGNK.DL..DE..R.ELAKMKQEP
Retrocopy
ENHMADIKVNRK*VVIALW\DTAGQEGRDRLRPLSYPDTDVILMCFFLNNFGSIETLPEKRNMEGKHFCPNVHIILVGNKNDLLKDECMRQELAKMKQEP


Parental protein
VRSEE
.R...
Retrocopy
MRPDK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide