RetrogeneDB ID:
retro_ecab_935
Organism:
Horse ( Equus_caballus )
Location:
7:68287157-68287438 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
57.0 %
Coverage:
97.03 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
SUMO1
Parental gene aliases:
No gene alias available
Parental gene description:
small ubiquitin-like modifier 1 [Source:HGNC Symbol;Acc:12502]

Genomic region (view in browser)





>retro_ecab_935
AACCAAGACGTAAAAGTTTCCACCAAGGAAGTGAGGTACAAGAAAGAAAGATAATACATC
TAATTCAAAGTCATCAGATAGGACAGCAGTGAAAGTCACTTCAAGGGAAAAATGACAACA
CATCTCAAGAAACTCAAAAAAACCATACTATCAAATACATCGAGTTGCCATGAATTCATT
CATGTTTCTCTTTGCTGATACTCACACTCCAAAAGGACTGGCAATGAAGCAGGAAGATGT
GACTGAAATCTTTCAGGAACAAACGGGTAGGTTATTCAACA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKES-YCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTG-GHST
.Q..K.ST.....KKE..YI..KVI..DSSE.HFK.KMTTHLKKLK...Y.Q...V.MNS..F.F.....AD.HTPK.L.M..EDV.E..QEQTG.G.ST
Retrocopy
NQDVKVSTKEVRYKKER*YI*FKVIR*DSSESHFKGKMTTHLKKLKKT\YYQIHRVAMNS--FMF---LFADTHTPKGLAMKQEDVTEIFQEQTG\GYST


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide