RetrogeneDB ID:
retro_ecab_937
Organism:
Horse ( Equus_caballus )
Location:
7:74532490-74533438 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.81 %
Coverage:
99.69 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
ANKRD40
Parental gene aliases:
No gene alias available
Parental gene description:
ankyrin repeat domain 40 [Source:HGNC Symbol;Acc:28233]

Genomic region (view in browser)





>retro_ecab_937
ACCTGTGTACACCGGATATGTAAACACAGTCATGACCAGGTGGTCTCTAACTTGTTAAAA
TGAGCATCTGACAGAGAAATTCTTACCACAAAAGGAGAAATGCCAGTCCAATTAACATCA
AGGAGAGAAATTAGGAAGATTATGGGAGTAGAAAATGATTATGATGAAGAAAACTACCCC
CAGTTTAAGAAGGAGACAGACCTACCTTTTGTTCCTAATTGTTTGGCCAAGACAGACTTC
CATTTTATCTACAATCCCACAGTAGAGGATTCAGCCCAACTGCAGAATGGGGGCTCATCT
TCACCTCCTGCATCACTTCTTGTGGATGGCTCACCTCCGTTGCTCCTTCATAGGGACCCT
CCCCTGCTGGGAACCTTTTTGTGGGACCACACCTCTTGACACTGGTTCAGAACTAGGAGG
TGTCTGCCCCCTCTGCCATACTCAGAACACCAGAAAGCACAAAACCGGAGACTGTTCGTT
AGTCACCAGGGAGTCACAGTCGCTCACTGTTCTCTTCTGTCCTGTCCAACCTGCCAGTGT
TGCTGGAGCTGCAAAATGGGATGTTTACACGACTGCTGCCAGCATTCCCTCCATTTTTAC
TCACTGGAGCATTTCCATTTAATATGCAAGAGCTAGTACTTAAGATGAGGGTTCAGAACC
CATCTCTTTGAGAAAATGATTTTGTTAAAATTGAACTGGCCCTTCAGGAGCTTACCTACC
ACAAATTGCTCAGAATGACTTACTGTGCCCTGAGTGTTAATCCGGATAAGTGGAGATCAG
AAAGGTATCCAGTGCTCTGGTAAGAAAAGACAAAGATGTTGCTCAACTTCAAGATTTCCA
AGAGTTGGAACTGATTCTAATGATAAGTGAAAATAATTTTTCTTCAGAAATGCTGCATCC
ACACTGACTGAAAGGTCTTGCTACAACAAGAGAGCTTCAAAACTGACT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TCLHWACKRNHGQVVSYLLKSGADKEILTTKGEMPVQLTSRREIRKIMGVEDDNDDDDNLPQLKKESELPFVPNYLANPAFPFIYTPAAEDSAQLQNGGP
TC.H..CK..H.QVVS.LLK...D.EILTTKGEMPVQLTSRREIRKIMGVE.D.D...N.PQ.KKE..LPFVPN.LA...F.FIY.P..EDSAQLQNGG.
Retrocopy
TCVHRICKHSHDQVVSNLLK*ASDREILTTKGEMPVQLTSRREIRKIMGVENDYDEE-NYPQFKKETDLPFVPNCLAKTDFHFIYNPTVEDSAQLQNGGS


Parental protein
STPPASPPADGSPPLLSPGNPPLLGAFPRDHTS-LALVQNGDVSAPSAILRAPESTKPGPVCQPPVSQSRSLFSSVPSKPPVSLEPQNGTYAGPAPAFQP
S.PPAS...DGSPPLL....PPLLG.F..DHTS.L.LVQN..VSAPSAILR.PESTKP..V...P.S.SRSLFSSV.S..PV.LE.QNG......PAF.P
Retrocopy
SSPPASLLVDGSPPLLLHRDPPLLGTFLWDHTS/LTLVQN*EVSAPSAILRTPESTKPETVR*SPGSHSRSLFSSVLSNLPVLLELQNGMFTRLLPAFPP


Parental protein
FFFTGAFPFNMQELVLKVRIQNPSLRENDFIEIELDRQELTYQELLRVSCCELGVNPDQ-VEKIRKLPNTLVRKDKDVARLQDFQELELVLTISENN-FL
F..TGAFPFNMQELVLK.R.QNPSL.ENDF..IEL..QELTY..LLR...C.L.VNPD..VE.IRK....LVRKDKDVA.LQDFQELEL.L.ISENN.F.
Retrocopy
FLLTGAFPFNMQELVLKMRVQNPSL*ENDFVKIELALQELTYHKLLRMTYCALSVNPDK/VE-IRKVSSALVRKDKDVAQLQDFQELELILMISENN/FF


Parental protein
FRNAASTLTERPCYNRRASKLT
FRNAASTLTER.CYN.RASKLT
Retrocopy
FRNAASTLTERSCYNKRASKLT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide