RetrogeneDB ID:
retro_ecab_94
Organism:
Horse ( Equus_caballus )
Location:
X:79778264-79779614 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
96.67 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_94
ATGATGCTGAGCACAGAAGGCAGGGAGGGGTTCGTGGTGAAGGTCAGGGGCCTACCCTGG
TCCTGCTCAGCTGACGAAGTGATGCGCTTCTTCTCCGATTGCAAAATCCAAAATGGCACA
TCTGGCATTCGTTTCATCTACACCAGAGAAGGCAGACCAAGCGGTGAAGCATTTGTCGAA
CTTGAATCTGAAGATGAAGTGAAATTGGCTTTGAAGAAGGACAGAGAAACCATGGGACAC
AGATATGTTGAAGTATTCAAGTCCAACAGTGTTGAAATGGATTGGGTGTTGAAGCATACA
GGTCCGAATAGTCCTGATACTGCCAATGATGGCTTCGTCCGGCTTAGAGGACTCCCATTT
GGCTGTAGCAAGGAAGAGATTGTTCAGTTCTTTTCAGGGTTGGAAATTGTGCCAAATGGG
ATGACACTGCCGGTGGACTTTCAGGGGCGGAGCACAGGGGAGGCCTTTGTGCAGTTTGCT
TCACAGGAGATAGCTGAAAAGGCCTTAAAGAAACACAAGGAAAGAATAGGGCACAGATAC
ATTGAGATCTTCAAGAGTAGCCGAGCTGAAGTCCGAACCCACTACGACCCCCCTCGAAAG
CTCATGGCTATGCAGCGGCCGGGTCCCTATGATAGGCCGGGGGCTGGCAGAGGGTATAAT
AGCATTGGCAGAGGGGCTGGATTTGAAAGGATGAGGCGGGGTGCCTATGGTGGAGGGTAT
GGAGGCTATGATGATTACGGTGGCTATAATGATGGGTACGGCTTTGGGTCTGATAGATTT
GGAAGAGACCTCAATTACTGCTTTTCGGGAATGTCTGATCATAGATATGGAGATGGTGGG
TCCAGTTTCCAGAGCACCACAGGGCACTGTGTACACATGAGGGGGTTACCTTACAGAGCC
ACTGAGAATGATATTTACAATTTTTTCTCACCTCTTAACCCCATGAGAGTACACATTGAA
ATTGGACCCGATGGCAGAGTTACTGGGGAGGCAGACGTTGAATTTGCTACTCATGAAGAT
GCTGTGGCAGCTATGGCAAAAGACAAAGCTAATATGCAACACAGATATGTGGAGCTTTTC
TTGAATTCTACTGCAGGAACAAGCGGGGGGGCTTACGATCACAGCTATGTAGAGCTCTTT
TTGAATTCTACAGCAGGGGCAAGTGGTGGTGCGTATGGTAGCCAAATGATGGGAGGGATG
GGCTTATCCAATCAGTCTAGTTATGGGGGTCCTGCTAGCCAGCAGCTGAGTGGTGGTTAC
GGAGGTGGTTATGGTGGTCAGAGCAGTATGAGTGGTTATGACCAAGTTCTGCAGGAGAAC
TCCAGTGATTACCAGTCCAACCTCGCCTAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 64.99
SRP021940_cerebellum 73.88
SRP021940_embryo 62.48
SRP021940_placental_villous 52.72
SRP021940_synovial_membrane 41.44
SRP021940_testis 24.09

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FFPDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQ
FF.DCKIQNG..GIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSN.VEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQ
Retrocopy
FFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQ


Parental protein
FFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFE
FFSGLEIVPNG.TLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFE
Retrocopy
FFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFE


Parental protein
RMRRGAYGGGYGGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPVRVHIEIGPDGRVTG
RMRRGAYGGGYGGYDDY.GYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGS.FQSTTGHCVHMRGLPYRATENDIYNFFSPLNP.RVHIEIGPDGRVTG
Retrocopy
RMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTG


Parental protein
EADVEFATHEDAVAAMSKDKANMQHRYVELFLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSS
EADVEFATHEDAVAAM.KDKANMQHRYVELFLNSTAG.SGGAY.H.YVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSS
Retrocopy
EADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSS


Parental protein
MSGYDQVLQENSSDFQSNIA
MSGYDQVLQENSSD.QSN.A
Retrocopy
MSGYDQVLQENSSDYQSNLA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide