RetrogeneDB ID:
retro_ecab_942
Organism:
Horse ( Equus_caballus )
Location:
7:92666093-92666782 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.96 %
Coverage:
51.91 %
Frameshifts:
4
Stop codons:
4


Parental gene:
Parental gene symbol:
NAE1
Parental gene aliases:
No gene alias available
Parental gene description:
NEDD8 activating enzyme E1 subunit 1 [Source:HGNC Symbol;Acc:621]

Genomic region (view in browser)





>retro_ecab_942
ATGAATTTCTTACAGGAATTAAATAACAATGGATCTGGAAGGCTGTGGACGAAAGTTCAG
AAAACCTTCTAAACAATGACCTTTCTTCTTCCTGTAGATTTACCGCTGTGGTTGCACCTA
GGCTCCCTGAAAGTACATTACTATATTTAGCTGATGTCCTCCAGAATTCTCAAATCTCCC
TTTTAATCTATGGGACATACATGGCTTTTGGCGATAGGAGGAACATTATAAAAGAACATC
CGGTAATAGAATTTCACCAAGATAAAACAAAGAAGATCTACAACTGGATAAACCGTTTCT
GAACTGAGAGAACATTTTCAATCTTACAGTTTGGATTATACAGGAAAAGACAAGACCATA
GCAACACTGTAGATTGTGATCATAGCTAAATATTTAGCATAGTGGAATAGTGACACAAAT
GGATGAACACCCAAAATGTGTCAAGGAAAAGAAGACTTCAGAGATTTGATCAGACCAGGG
ATTCTAAAGAATGAAATGAGGGCTCCAGAAGATGAAGAGAATTTTGAGGAAGCTATTAAA
AATATAAACACAGCAATAAATACAGCTCAGATCCCAATCAATATTAAAGATATTTTAATG
AGAATTGCTGCATAAATATCAGCCAACAGACTCCATTCTTTTAGCTTTTAGCTTATGCCT
TAAAGGACTTTGTGGACAAAGAGGCACAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEFLQELNNDVSGSF-VEESPENLLDNDPSFFCRFTIVVATQLPESTLLRLADVLWNSQIPLLVCRTYGLVGYMRIIIKEHPVIESHPDNAL-EDLRLDK
M.FLQELNN..SG...V.ES.ENLL.ND.S..CRFT.VVA..LPESTLL.LADVL.NSQI.LL...TY...G..R.IIKEHPVIE.H.D....EDL.LDK
Retrocopy
MNFLQELNNNGSGRL/VDESSENLLNNDLSSSCRFTAVVAPRLPESTLLYLADVLQNSQISLLIYGTYMAFGDRRNIIKEHPVIEFHQDKTK/EDLQLDK


Parental protein
PF-PELREHFQSYDLEHMEKKDHSHTPWIVIVAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIE
PF..ELREHFQSY.L....K.....T..IVI.AKYLA.W.S.TNG..PK....KEDFRDLIR.GILKNE..APEDEENFEEAIKN.NTA.NT.QIP..I.
Retrocopy
PF/SELREHFQSYSLDYTGKDKTIATL*IVIIAKYLA*WNSDTNG*TPKMCQGKEDFRDLIRPGILKNEMRAPEDEENFEEAIKNINTAINTAQIPINIK


Parental protein
DI-FNDDRCINITKQTPSFWILARALKEFVAKEGQ
DI.FN...CINI..QTP.F..LA.ALK.FV.KE.Q
Retrocopy
DI/FNENCCINISQQTPFF*LLAYALKDFVDKEAQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide