RetrogeneDB ID:
retro_ecab_943
Organism:
Horse ( Equus_caballus )
Location:
7:97269425-97269800 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
56.15 %
Coverage:
57.92 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
CIDEB
Parental gene aliases:
No gene alias available
Parental gene description:
cell death-inducing DFFA-like effector b [Source:HGNC Symbol;Acc:1977]

Genomic region (view in browser)





>retro_ecab_943
AAAGATGACACGTACCTGAGAGTGCCAAAGTTCAGGCAAAGCTGGGGCTCCAGCACGAGT
GGGTGCTGTCACATGGCCTGGGCTGGGAGAAGCCCAAGCACAGCAAGGACATTGCCCTTG
TCACCCTCAACCTATCTAAGCAAAACCCGTGAGACCTCTTTAGCAGCCTGAACGTCACAG
CCACATTCTACGAGCTCTACTGCAGGAGTCATGACTTTCAAGGAGTTGGCCCAGAGAAAG
GACTCAGGGCACACCTCCAGTTGGACCTCCATGCTACTGTAAGGACTGGGCCACATGCTG
CCAGGGATTTCCTCCCCCTTCCACCACGCAATGGAGGCTCAGCAATGGTGGCGGCAGGGG
TGCCTTCGTGCCTAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.2
SRP021940_embryo 0.07
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EDDTCLMVLESGQSWSPIRSR-VLSYGLGREKPKHSKDIARITFDVYKQNPRDLFGSLNIKATFYGLYSMSCDIQGLGPKKVLRELLR-WISALLQGLGH
.DDT.L.V....QSW....S..VLS.GLG.EKPKHSKDIA..T....KQNP.DLF.SLN..ATFY.LY..S.D.QG.GP.K.LR..L..W.S.LL.GLGH
Retrocopy
KDDTYLRVPKFRQSWGSSTSG/VLSHGLGWEKPKHSKDIALVTLNLSKQNP*DLFSSLNVTATFYELYCRSHDFQGVGPEKGLRAHLQ\WTSMLL*GLGH


Parental protein
ILLGISSTLRHVVEGAEQWQLQRQGRLHRY
.L.GISS...H..E....W...RQG.L..Y
Retrocopy
MLPGISSPFHHAMEAQQWW---RQGCLRAY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide