RetrogeneDB ID:
retro_ecab_944
Organism:
Horse ( Equus_caballus )
Location:
7:4145055-4145793 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
90.65 %
Coverage:
61.65 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
LANCL1
Parental gene aliases:
No gene alias available
Parental gene description:
LanC lantibiotic synthetase component C-like 1 (bacterial) [Source:HGNC Symbol;Acc:6508]

Genomic region (view in browser)





>retro_ecab_944
GGACCGATGGGCCACATCCATGCTCTTCTCTTTGCCAATAAGCACTTTGGAGTGGAAAAG
ATTCCTCAAAGCCACATTCAGTAGATTTGTGAAACAGTCTTAACCTCTGGAGAAAACCTA
GCTAGAAAGAAGAATTTAACAGCAAAGACTCCACTGGTGTATGAATGGTACCAAGAATAT
TACGTGGGGGCTGCTCACGGCCTGGCAGGAATTTACTACCTCCTGATGCAGCCCAGCCTT
CAGGTGAGCCATGCGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTATGTCTGCCAG
CTGAAATTCCCTTCTGGCCATTGCCCTCCACGTGTGGACAATACTCAAGATCTGCTAGTC
CACTGGTGCCACGGTGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTGTTC
AGAGAGGAGCGCTATCTCAGCGACGCCCGGCAGAGCGCTGACCTGACCTGGCAGTACGGG
CTGCTGAAGAAGGGCTACTGGCTGTGCCACGGCGCTGCGGGCAACGCCGACGCCTTCCTG
GCGCTGTTCAACCTCACACAGGCCAGGAAGTACCTGTACAGGGCCTGCAAGTTCGCTGAG
TGATGCTTGGATTACGGAGAACATGGGTGCAGAACACCGGACAACCCCTTCTCCCTCTTT
GAAGGAATGGCTGGAACAATCTATTTCCTGGCTGACCTGCTAGTGCCAGAGAAAGCCTGG
TTCCCTGCATTTGAACTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 1.42

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GRMGYIYALLFVNKHFGVEKIPQSHIQQICETVLTSGENLARKRNFTAKTPLMYEWYQEYYVGAAHGLAGIYYFLMQPSLQVSHAKLHSLVKPSVDYVCQ
G.MG.I.ALLF.NKHFGVEKIPQSHIQ.ICETVLTSGENLARK.N.TAKTPL.YEWYQEYYVGAAHGLAGIYY.LMQPSLQVSHAKLHSLVKPSVDYVCQ
Retrocopy
GPMGHIHALLFANKHFGVEKIPQSHIQ*ICETVLTSGENLARKKNLTAKTPLVYEWYQEYYVGAAHGLAGIYYLLMQPSLQVSHAKLHSLVKPSVDYVCQ


Parental protein
LKFPSGNYPPCVDDTRDLLVHWCHGAPGVIYMLIQAWKVFREERYLTDARQSADLIWQYGLLKKGYGLCHGAAGNAYAFLALFNLTQDRKYLYRACKFAE
LKFPSG..PP.VD.T.DLLVHWCHGAPGVIYMLIQA.KVFREERYL.DARQSADL.WQYGLLKKGY.LCHGAAGNA.AFLALFNLTQ.RKYLYRACKFAE
Retrocopy
LKFPSGHCPPRVDNTQDLLVHWCHGAPGVIYMLIQAYKVFREERYLSDARQSADLTWQYGLLKKGYWLCHGAAGNADAFLALFNLTQARKYLYRACKFAE


Parental protein
WCLDYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPEKARFPAFEL
.CLDYGEHGCRTPD.PFSLFEGMAGTIYFLADLLVPEKA.FPAFEL
Retrocopy
*CLDYGEHGCRTPDNPFSLFEGMAGTIYFLADLLVPEKAWFPAFEL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide