RetrogeneDB ID:
retro_ecab_945
Organism:
Horse ( Equus_caballus )
Location:
7:6182891-6183233 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.91 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL30
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L30 [Source:HGNC Symbol;Acc:10333]

Genomic region (view in browser)





>retro_ecab_945
ATGGTGGCCGCAAAGAAGACCAAAAAGTCGCTTCAGTCGGTCAACTCTAGGCTCCAGCTG
GTAACGAAAAGTGGAAAGTACATGCTGAGGTACAAGCTGACTCTGAAAATGATCAGACAA
GGCAAAGCGAAACTGGGCATCCTTGCCAACAACCGCCCAGCCCTGAGGAAATCCGAAACG
GAGTGCTACACCACGCTGGCCAACACTGGGCCTCACGACAGTGGCAGGAATGTTAAATAG
GGCACAACCTGTGGAAAATACCACAGATAATCCATGCTGGCTATCATTGATCCGGGAGAT
TCTGATAGCGTTAGGAGCATGCCACAACAGGCTGATGAAAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.05
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 5.76

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPG
MVAAKKTKKSL.S.NSRLQLV.KSGKY.L.YK.TLKMIRQGKAKL.ILANN.PALRKSE.E.Y..LA.TG.H..SG.N...GT.CGKY.R...LAIIDPG
Retrocopy
MVAAKKTKKSLQSVNSRLQLVTKSGKYMLRYKLTLKMIRQGKAKLGILANNRPALRKSETECYTTLANTGPHD-SGRNVK*GTTCGKYHR*SMLAIIDPG


Parental protein
DSDIIRSMPEQTGEK
DSD..RSMP.Q..EK
Retrocopy
DSDSVRSMPQQADEK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide