RetrogeneDB ID:
retro_ecab_95
Organism:
Horse ( Equus_caballus )
Location:
X:73374980-73375730 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.63 %
Coverage:
97.98 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
FAM133B
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 133, member B [Source:HGNC Symbol;Acc:28629]

Genomic region (view in browser)





>retro_ecab_95
ATGGGGAAGCGAGATAATCGGGTGGCATATATGAATCCTATAGCGATGGCCAGATGGAGG
GGCCCAACTCAATCTGCAGGTCCAACAATACAAGATTATCTGAATCGACCAAGGCCCACA
TGGGAAGAAGTGAAGAAACAATTAGAAAATAAAAAGAAAGGCTCCAAGGCATTAGCTGAA
TTTGAAGAAAAAATGAACGAGAATTGGAAGAAAGAACTAGAAGAAAGCAGAGAGAAATTA
TTAAGTGGAAATGAGAGTTCATCCAAAAAAAGAGAGAGAAAGAAAAAGAAAAAGAAGAAG
TCTTCTCGGTCTTCGTCATCTTCTTCATCAAGCTCTGATTCTTCAAGCAGTTCTTCAGAT
TCTGAAGATGAGGAAAAGAAACAAGGTAAAAAGAGAAAGAAAAAGAAGAATCGTTCACAC
AAATCATCACAAAGCTCTACATATGAATCTGAGTCAGAGAGCAAGGAATATGTAAAAAAG
AAAAAGAAGTCACAAGATGAAACAGAGAAAGAAAAGGATGTCAGAAGTCTCAGCAAAAAA
AGAAAGAAGACGTATCCTGAGGATAAACCTTTATCATCGGAGTCCTCATCAGAATCAGAT
TATAAAGAGGAGGTACAAGCAAAAAAGAAGAGAAGATGTGAAGAGCAAGAAAAAGCAATG
GAAAAAGCAAAGAAGAAGAAAAAAAAACAGCACAAGAAACATAGTAAGAAGAAGAAAAAG
AAGTCAGGTTCAAGTCACAAGTCGGAATAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.41
SRP021940_cerebellum 0.2
SRP021940_embryo 0.77
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.13
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWKKELEKHREKLLSGSESSSKKRQRKKKEKKK
MGKRDNRVAYMNPIAMAR.RGP.QS.GPTIQDYLNRPRPTWEEVK.QLE.KKKGSKALAEFEEKMNENWKKELE..REKLLSG.ESSSKKR.RKKK.KKK
Retrocopy
MGKRDNRVAYMNPIAMARWRGPTQSAGPTIQDYLNRPRPTWEEVKKQLENKKKGSKALAEFEEKMNENWKKELEESREKLLSGNESSSKKRERKKKKKKK


Parental protein
SGRYSSSSSSSSDSSSSSSGSEDEDKKQGKRKKKKKNRSHKSSESSISETESDSKDSLKKKKKSKDATEKEKDIKGLSKKR-KMYPEDKPLSSESLSESD
S.R.SSSSSSSSDSSSSSS.SEDE.KKQGK..KKKKNRSHKSS.SS..E.ES.SK...KKKKKS.D.TEKEKD...LSKKR.K.YPEDKPLSSES.SESD
Retrocopy
SSRSSSSSSSSSDSSSSSSDSEDEEKKQGKKRKKKKNRSHKSSQSSTYESESESKEYVKKKKKSQDETEKEKDVRSLSKKRKKTYPEDKPLSSESSSESD


Parental protein
YIEEVRAKKKKSSEEREKTTEKTKKKKK--HKKHSKKKKKKAASS
Y.EEV.AKKK...EE.EK..EK.KKKKK..HKKHSKKKKKK..SS
Retrocopy
YKEEVQAKKKRRCEEQEKAMEKAKKKKKKQHKKHSKKKKKKSGSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide