RetrogeneDB ID:
retro_ecab_951
Organism:
Horse ( Equus_caballus )
Location:
7:28075078-28075439 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.21 %
Coverage:
92.2 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
FAU
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-like protein fubi and ribosomal protein S30 [Source:RefSeq peptide;Acc:NP_001157337]

Genomic region (view in browser)





>retro_ecab_951
CAGAAGCTACCCACCCTCAGGTGACCAGCCAGGAGACAGTCGCCCAGATCAAGGCTCCCG
TAGCCTCGTTGGTGGGCCTCGCTCCAGAAGATGAGGTCGTGCTCCTGCAGGCTGGCCCCC
AGAGGATGAGGCTACCCTGGGCCAGCGGCTGACCACTCTGGAAGTAGCCGGCTGCATGCT
TGGAGGTGAAGTCACTGGTTCCCTGGCCTGTGCTGGGCAAGTAAGAGGTCAGACTCCGGA
CGTGGCCAAACAGGAGACAAAGAAGAAGACAGGCGGGGCCACGCGGCGGATGTGGTACAA
CCAGCGCTTTGTCAGTGTTGTGCCCGCCTTTGGCAAGAAGACAGGCCCCAATGCCAACTC
T

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.1
SRP021940_embryo 0.07
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QELHTL-EVTGQETVAQIKAYVASLEGIAAEDQVVLL-AGTPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVSESVAKQEKKKK
Q.L.TL..VT.QETVAQIKA.VASL.G.A.ED.VVLL.AG.P.EDEATLG......LTTLEVAG.MLGG.V.GSLA.AG.VRGQTP.....VAKQE.KKK
Retrocopy
QKLPTL/QVTSQETVAQIKAPVASLVGLAPEDEVVLL/AGWPPEDEATLG----QRLTTLEVAGCMLGGEVTGSLACAGQVRGQTP----DVAKQETKKK


Parental protein
KTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
.TG.A.RRM.YN.RFV.VVP.FGKK.GPNANS
Retrocopy
-TGGATRRMWYNQRFVSVVPAFGKKTGPNANS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide