RetrogeneDB ID:
retro_ecab_952
Organism:
Horse ( Equus_caballus )
Location:
7:30841955-30842306 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
96.61 %
Coverage:
68.6 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
MRPL13
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein L13 [Source:HGNC Symbol;Acc:14278]

Genomic region (view in browser)





>retro_ecab_952
GATCATGTTGTCATAATGAACACAAGGCACATTGCATTTTCTGGAAACAAATGGGAACAA
AAGGTGTATTCCTCACATACTGGCTACCCAGGTGGATTGAAACAAGTAACAGCTGCTCAA
CTTCACCAGAAGGATCCAGTGGCAATTGTAAAACTGGCTATTTATGGCATGCTGCCAAAA
AACCTTCACAGAACTATGATGCAGAGGTTGCATCTTTTCCCAGATGAAGACATACCAGAA
GATATTCTTAAGAATTTAGTGGAAGAGCTTCCTTAACCTCGGAAAGTACCCAGACGTCTA
GATGAGTGCACACAAGAAGAAATAGAGGCTTTCCCAAGAGTGTGGTCCCCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.35
SRP021940_embryo 0.29
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFKQVTAAQLHQKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRKVPRR
DHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGG.KQVTAAQLHQKDPVAIVKLAIYGMLPKNLH.RTMMQRLHLFPDEDIPEDILKNLVEELP.PRKVPRR
Retrocopy
DHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGLKQVTAAQLHQKDPVAIVKLAIYGMLPKNLH-RTMMQRLHLFPDEDIPEDILKNLVEELP*PRKVPRR


Parental protein
LDEYTQEEIEAFPRVWSP
LDE.TQEEIEAFPRVWSP
Retrocopy
LDECTQEEIEAFPRVWSP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide