RetrogeneDB ID:
retro_ecab_956
Organism:
Horse ( Equus_caballus )
Location:
7:47171718-47172150 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.84 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
5


Parental gene:
Parental gene symbol:
SSBP1
Parental gene aliases:
No gene alias available
Parental gene description:
single-stranded DNA binding protein 1, mitochondrial [Source:HGNC Symbol;Acc:11317]

Genomic region (view in browser)





>retro_ecab_956
ATGTTTCAAAGACCTGTATGACAGGTTCCTCATCAGTGTGTAAGACATGAGTCTTTAGCA
GCTAGCAGCTTGATTCTCAGAGGATCTAGGGATCCTGTGCAGTCAATTGGATGAGTAGGT
GAGGACCCTGTCCTGAGACAGGTGGAAGGAAAAGGCCCAGTGACAATATCTTCTCTAGGA
ACAAATGAGGTGAGGTGAGGAGGAGAGAGTGAAGCACAGCAAATGGGTGATGTCAGTCAA
GACAACACGGCACAGAACTTCAGTATCCGGCCAGGCCTTGGAGACATGGCAGATGTGAAA
AAGGGTCTCAAACTGACATGGAAGGAAAAGTAGACTGGTGAATACAAGGATAAGAGTAAT
GTGAGGTGACAAGCAACAACAACCAGAGCTGATAACATTCTATTTCTGAGAGACCAGACA
AAAGAGAAGGCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.05
SRP021940_embryo 0.12
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.13
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MFRRPVLQVLHQFVRHESEIASSLVLERSLNRVQLLGRVGQDPVMRQVEGKNPVTIFSLATNEMWRSGESEAYQMGDVSQKTTWHRISVFRPGLRDVAYQ
MF.RPV.QV.HQ.VRHES..ASSL.L..S...VQ..G.VG.DPV.RQVEGK.PVTI.SL.TNE....GESEA.QMGDVSQ..T....S..RPGL.D.A..
Retrocopy
MFQRPV*QVPHQCVRHESLAASSLILRGSRDPVQSIG*VGEDPVLRQVEGKGPVTISSLGTNEVR*GGESEAQQMGDVSQDNTAQNFSI-RPGLGDMAD-


Parental protein
YVKKGSRIYVEGKVDYGEYTDKNNVRRQATTIIADNIIFLSDQTKEKA
.VKKG.......K...GEY.DK.NVR.QATT..ADNI.FL.DQTKEKA
Retrocopy
-VKKGLKLTWKEK*T-GEYKDKSNVR*QATTTRADNILFLRDQTKEKA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide