RetrogeneDB ID:
retro_ecab_960
Organism:
Horse ( Equus_caballus )
Location:
7:74632838-74633996 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.85 %
Coverage:
60.37 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
GSTCD
Parental gene aliases:
No gene alias available
Parental gene description:
glutathione S-transferase, C-terminal domain containing [Source:HGNC Symbol;Acc:25806]

Genomic region (view in browser)





>retro_ecab_960
GATACTTCACTACTTAAAAATGTATTGTCCCAGCATGTTCAAATCCAGATTATCTCGAGG
CAAGAGCTTCCACAGATAGTCCAGAATTGCTGTTTACCTGCAGTGGTAGAAGGACCAGAC
AGTTTCTACAGAGCAGGGCTCGCTGTTGTGCTGAGACACATCGTCCAGAAAGCATATGAC
GCAGAGCCCTCAAAGAAGGGGATCTTCGAGCTGCTGGATTTTAAGAAGACTTGTTTGAAG
GCCTGTGTTGAAGTTAGTCAGTAGACCAGGCTATGTAAACTTACCATCCCTTTAGCTATT
GAGAATTTTGTCAAAGAGTCTTGTGACCTGCACGCAGCTATCCCCACAGAAGTACTACAG
CTAGAGAAAAAGCTCAGCGAGCCTGTTGGAGTGCGCAACGATGACAAACTCTGTGAGCAA
AAGCTGAAGCAGCAGAAGGCTGCTGCAGTGGTGCCTGCTCTTGCCCAGGAGAAATTGAAG
GCCTGTAGACAGGAAACATCTGAGGACCAAGACCCTTCATCCCGCAGCCTGGAGCTGCAA
GTGGCCTTCTCAACGCTCACGGTACAGGGGCACCCAGCTGCTCCCAACAGGGAGCCTGCT
CACATCATACGAGCAGGCACCTGCGCGCTTCTGCTCCTGGAGCACCTGTTTGCAGAAGGC
CTGTACTTCGCCTTGGTAGACCTCGTACTTCTGCCCTGCAGCCATCACTTTTTGGTAATT
ATCCTCGAGAAGCTTTCTGAAAGGCTGGTAGAATTTCTGCTGCTGGCTGCCTGGTACCAG
AGGGCTCAGGAGGTGCCAGGAGTGAGAACAGCAGCTTCTTGCCATGGGACCTAGTTTCTC
CACTTACCAGAGTTGCCGACCACCTCCAGCGAACAGCATCCAAAATTCAGCAAGGCCCAG
GAGCAGAGGAGCACAGCGACCCTTCGTTTATGTTTAGTGGGCCCAAGACCCACTATGACC
AAGTTAATGGAAAAGGGCATTGAAGTGATGTTTTCTCCCCACCCTTGCTCTGCTTGGACC
CTTGACTGGAATAGACTTCCTGCAGCAGTGAGCCCAAAAGATGGGAAGACGTCCAGTGAT
TGAGCGCTGAGGAAGCAGCAGGAGTTAAGCAACCTCGTCTACGTGGTGACACATCAGGCC
AGGCCTGGGGACAGAATC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.1
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DTSLLKNVLSQHVEIQIISRQELPLIVQNCCLPAVVESPDSFCRAGLAVVLRHIVQRAYDAEPSKKGILELLGFKKTCLKACAEVSQWTRLCELTIPLSI
DTSLLKNVLSQHV.IQIISRQELP.IVQNCCLPAVVE.PDSF.RAGLAVVLRHIVQ.AYDAEPSKKGI.ELL.FKKTCLKAC.EVSQ.TRLC.LTIPL.I
Retrocopy
DTSLLKNVLSQHVQIQIISRQELPQIVQNCCLPAVVEGPDSFYRAGLAVVLRHIVQKAYDAEPSKKGIFELLDFKKTCLKACVEVSQ*TRLCKLTIPLAI


Parental protein
ENFLKESCDQHPAIPTEILQLEKKLSEPVRVHNDDKLRRQKLKQQKAAGAGPTLAQEKLKSQAHMQETSEDQDPSSQSLELQVAFSKLTVQEHPAAPNRE
ENF.KESCD.H.AIPTE.LQLEKKLSEPV.V.NDDKL..QKLKQQKAA...P.LAQEKLK..A..QETSEDQDPSS.SLELQVAFS.LTVQ.HPAAPNRE
Retrocopy
ENFVKESCDLHAAIPTEVLQLEKKLSEPVGVRNDDKLCEQKLKQQKAAAVVPALAQEKLK--ACRQETSEDQDPSSRSLELQVAFSTLTVQGHPAAPNRE


Parental protein
PAHIRRAGACALPPLEHVFAEGLYFTLADLVLLPCIHHFLVVICKKLSKRLVEFPLLAAWYQRVQEVPGVKTAASRCGIQFLHLPELPTTSIEQHPKFSE
PAHI.RAG.CAL..LEH.FAEGLYF.L.DLVLLPC.HHFLV.I..KLS.RLVEF.LLAAWYQR.QEVPGV.TAAS..G..FLHLPELPTTS.EQHPKFS.
Retrocopy
PAHIIRAGTCALLLLEHLFAEGLYFALVDLVLLPCSHHFLVIILEKLSERLVEFLLLAAWYQRAQEVPGVRTAASCHGT*FLHLPELPTTSSEQHPKFSK


Parental protein
A-AGAEEHSDPSFI-GGP-RPTMTKLMEKGIEVMFSPHPCPAWTLDWNRLPAAVSPKEGKMSSDRALRKQQQLNNLVYVVTHQARPGDRI
A..GAEEHSDPSF...GP.RPTMTKLMEKGIEVMFSPHPC.AWTLDWNRLPAAVSPK.GK.SSD.ALRKQQ.L.NLVYVVTHQARPGDRI
Retrocopy
A/PGAEEHSDPSFMFSGP\RPTMTKLMEKGIEVMFSPHPCSAWTLDWNRLPAAVSPKDGKTSSD*ALRKQQELSNLVYVVTHQARPGDRI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide