RetrogeneDB ID:
retro_ecab_962
Organism:
Horse ( Equus_caballus )
Location:
8:488206-489866 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
94.28 %
Coverage:
99.82 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
CNOT6
Parental gene aliases:
No gene alias available
Parental gene description:
CCR4-NOT transcription complex, subunit 6 [Source:HGNC Symbol;Acc:14099]

Genomic region (view in browser)





>retro_ecab_962
GGCATGCCCAAAGACAAATGCGAGCCCCCTGACCCTGGGAGGATGTACACAATTATGTCC
TCTGAGGAAGCAGCAAATGGAAAGAAATCACATTGGGCAGAGCTTGAAATAAGTGGAAAA
GTAAGAAGCTTAAGCTCATCTTTGTGGTCACTAACTCACCTGACAGCTTTGCATCTGAGT
GACAATTCCCTGTCCCGTATTCCTTCAGACATTGCCAAGCTTCACAATCTGGTGTATCTG
GACCTGTCTTCTAATAAAATCCGGAGTTTACCGGCAGAACTCGGAAACATGGTATCACTC
AGGGAACTCCATTTAAATAACAACCTGTTACGAGTTCTACCTTTTGAGCTGGGAAAACTG
TTTCAGTTGCAGACTTTAGGCCTGAAAGGAAATCCACTTACCCAAGATATATTGAACCTC
TATTTGGAACTAGATGGAACAAGAAGGCTACTGAACTATTTGCTTGATAATTTGGCAGTT
TCAACAGAACAACCACCTCCAAGATCTTGGATTATGTTACAAGAACCAGACAGAACAAGG
CCTTCTGCCTTGTTTTCTTTCATGTGCTACAATGTTCTTTGTGATAAATATGCGACCCGG
CAGTTATACGGCTACTGTCCGTCATGGGTGCTAAACTGGGACTACAGGAAAAAGGCCATT
ATTCAAGAAATCTTGAGCTGCAATGCTGATATCATAAGTCTTAAGGAGGTTGAAACAGAA
CAGTATTACAGTTTTTTTTCTGGTAGAACTGAAAGAACGTGGCTATAATGGATTCTTTAG
TCCTAAATCTAGAGCTGGGACAATGTCAGAACAAGAAAGAAAACATGTTGATGGCTGTGC
AATATTCTTCAAGACAGAAAAATTTACTTTGGTTCAGAAACACACTGTTGAATTTAATCA
GCTAGCGATGGCAAATTCAGAAGGGTCTGAAGCTATGCTGAACAGAGTCATGACAAAAGA
TAACATTGGAGTTGCAGTACTGCTAGAACTTCGAAAGGAATTGATTGAAATGTCATCTGG
AAAGCCACGTCTTGGAACAGAAAAACAACTGATTCTCGTGCCTAATGCTCATATGCATTG
GGACCCTGAATACTCTGATGTGAAGTTGGTTCAGACAATGATGTTCCTCTCAGAAGTGAC
GAACATTATTGACAAAGCCTCACGGAGCCTCCAGTCCAGTGTCTTGGGAGAGTTTGGAGC
TATTCCATTGGTGGTGTGTGCAGATCTTAATTCTTTGCCAGACTCTGGTGATGTAGAATA
TTTGAGCACTGGTGGAGTAGAAACAAACCATAAAGACTTTAAGGAGCTGAGATATAATGA
AAGTCTCACAAACTTCAGCTGCAATGGGAAAAATGGGACGACCAATGGCAGGATCACGCA
TGGGTTCAAGTTAAAGAGTGCCTACGAGAGTGGCCTGATGCCTTACACGAACTACACCTT
CGATTTCAAGGGTATAATTGACTACATCTTCTACTCTAAACCTCAGCTGAACACTTTAGG
CATCCTGGGACCTCTGGACCACCATTGGCTAGTTGAGAATAATATCAGTGGTGGCCCACA
CCCACTCATCCCCTCTGATCACTGCTCACTTTTTGCACAACTGGAGCTCTTACTGCCTTT
CCTGCCCCAAGTAAACGGCATTCACCTTCCCAGCAGGAGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.17
SRP021940_cerebellum 0.15
SRP021940_embryo 0.17
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GMPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSSSLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSL
GMPK.K.EPPDP.RMYTIMSSEEAANGKKSHWAELEISGKVRSLSSSLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSL
Retrocopy
GMPKDKCEPPDPGRMYTIMSSEEAANGKKSHWAELEISGKVRSLSSSLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSL


Parental protein
RELHLNNNLLRVLPFELGKLFQLQTLGLKGNPLTQDILNLYLEPDGTRRLLNYLLDNLAGTAKRISTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCD
RELHLNNNLLRVLPFELGKLFQLQTLGLKGNPLTQDILNLYLE.DGTRRLLNYLLDNLA..........PP.RSWIMLQEPDRTRP.ALFS.MCYNVLCD
Retrocopy
RELHLNNNLLRVLPFELGKLFQLQTLGLKGNPLTQDILNLYLELDGTRRLLNYLLDNLAVSTE----QPPP-RSWIMLQEPDRTRPSALFSFMCYNVLCD


Parental protein
KYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQEVETEQYY-SFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKH
KYATRQLYGYCPSW.LNWDYRKKAIIQEILSCNADI.SL.EVETEQYY....LVELKERGYNGFFSPKSRA.TMSEQERKHVDGCAIFFKTEKFTLVQKH
Retrocopy
KYATRQLYGYCPSWVLNWDYRKKAIIQEILSCNADIISLKEVETEQYY\XXXLVELKERGYNGFFSPKSRAGTMSEQERKHVDGCAIFFKTEKFTLVQKH


Parental protein
TVEFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKELIEMSSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLQSSV
TVEFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKELIEMSSGKP.LGTEKQLILV.NAHMHWDPEYSDVKLVQTMMFLSEV.NIIDKASRSLQSSV
Retrocopy
TVEFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKELIEMSSGKPRLGTEKQLILVPNAHMHWDPEYSDVKLVQTMMFLSEVTNIIDKASRSLQSSV


Parental protein
LGEFGAIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGTTNGRITHGFKLKSAYESGLMPYTNYTFDFKGIIDYIFYSKP
LGEFGAIPLV.CADLNSLPDSG.VEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGTTNGRITHGFKLKSAYESGLMPYTNYTFDFKGIIDYIFYSKP
Retrocopy
LGEFGAIPLVVCADLNSLPDSGDVEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGTTNGRITHGFKLKSAYESGLMPYTNYTFDFKGIIDYIFYSKP


Parental protein
QLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLELLLPFLPQVNGIHLPSRR
QLNTLGILGPLDHHWLVENNISG.PHPLIPSDH.SLFAQLELLLPFLPQVNGIHLPSRR
Retrocopy
QLNTLGILGPLDHHWLVENNISGGPHPLIPSDHCSLFAQLELLLPFLPQVNGIHLPSRR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide