RetrogeneDB ID:
retro_ecab_964
Organism:
Horse ( Equus_caballus )
Location:
8:2102164-2102765 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.41 %
Coverage:
76.21 %
Frameshifts:
8
Stop codons:
1


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_ecab_964
AAGAAGGGTGCAAAGGCAGCACATGTGACAGGCCTGGCAGAGCTGCAGTGCACACAGTAA
ATGTGCAACAGCCCGGGGCCAGCACAGCCACTGGTCAAGTCGCAGGGGCTTCCACACACC
CCCCAACAGAACCACCAGAATAGTGAGAGCATAAAGAACATGGGATCACAGAGTGCTCCC
GAAGGCCAGGCCCCACATCACCGGCCTGACCACATGCAGCCACTGTCCCCATCTCACAAC
ATTCGGAGACCCTACGGGTGACAACCACAGTATTCCAGCCCTCCTGTGCAGGGAGAAGTG
ATGGAGGGAACTGACACCCAGGTGCAGGAGAACAAGGCAGACCAGTAGACAGAAGCTGTA
TCGGGGTATAGACCACAGTGCCGCAGGGGGCCTCCTCACAAAAGACAGTCAGAGAAGATG
GCCATGCAGATCAGGAAGATCGAGGACAGGAGACCTACTGTAAGCAGCCACCTCAACGTC
AGCACCACCGCACCTTCAACGACCAACACAGAGGCCAAGAAATCCCAAGACCACAAGATG
GCCAGGAGACGAAAGCAGCTGCCCCCCAGCTGAGAACCCCCCTCCTGGGGCTGAGCAGGG
C

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EKGAEAANVTG-PGGVPVQG-SKYAADRNHYRRYPRRRG-PPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRP-YRRRRFPPYYMRRPYGRRPQYSNPP
.KGA.AA.VTG.PG...V...SK.A..R........RRG..P...QQN.QNSES..KN.GS.SAPEGQA...RP.......P....RRPYG..PQYS.PP
Retrocopy
KKGAKAAHVTG/PGRAAVHT/SKCATARGQHSHWSSRRG/LPHTPQQNHQNSES-IKNMGSQSAPEGQAPHHRPDHMQPLSPSHNIRRPYG*QPQYSSPP


Parental protein
VQGEVMEGADNQ-GAGEQGRPV-RQNMYR-GYRPRFRRGPPRQRQP-REDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAAD-
VQGEVMEG.D.Q.GAGEQGRPV.RQ..YR.GYRP..RRGPP..RQ..REDG...D.E..G.ET...QPPQR...R.FN...R..E.P.PQDG.ETKAA..
Retrocopy
VQGEVMEGTDTQ/GAGEQGRPV/RQKLYR/GYRPQCRRGPPHKRQS/REDGH-ADQEDRGQETYCKQPPQRQHHRTFNDQHRGQEIPRPQDGQETKAAA/


Parental protein
PPAENSSAPEAEQG
PPAEN...P.AEQG
Retrocopy
PPAEN-PPPGAEQG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide