RetrogeneDB ID:
retro_ecab_965
Organism:
Horse ( Equus_caballus )
Location:
8:2211247-2211950 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.56 %
Coverage:
89.96 %
Frameshifts:
10
Stop codons:
2


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_ecab_965
ACCAGGGAAGATGTACTGGTACCCAGACCGCCACAGAGGAGGAAGTCCAGCGGGGACCTT
CACAGTGCAGGAGATGGGGAGACTGTGCAGTTTGATGCTGCTGAGGGAGATGGGGGCAGA
GGGCCAAATGTGACAGGCCTGGCAGAGCTTCAGTGCACACAGTAAATGTGCAGCACCCTG
GGGCCAGCATAGCCGCTGTTCAAGTCAAAGGGGCCTCCACACACCCTCCAGCAGATCCAC
CAGAATAGTGAGAGCATGAAGAATGTGGGATCAGAGAGAGCTCCCAAAGGTCAGGCTCCA
TGCCAGCCCGACCACACGCAGGCCTCGGTCCCCACCTCACTACATGTGGAGACCTTACGG
GTGACAACCACAGTGTTCCAGCCCTCCTGTGCAGAGAGAAGTGATGGAGGGGACTGACAG
CCAGATGCAGGAGAACAAGGCAGACCAGTAGACAGAAGCTGTATCGGGGTATAGACCACA
GTGCCGTAGGGGCCTCCTCACCAAAGACAGCCAGAGAGGATGGCCAAGCATATCAGGAAG
ATCGAGGACAGGAGACCTACTATAAGCAGCCACCTTAACGTCAGCACCGCCGCACCTTCA
ACGACCGACACAGAGGCCAAGAAATCCCTAGACCACAAGATGGCCAGGAGACGAAAGCAG
CTGACCCCCAGCTGAGAACCCCCCTCTCAGGGCTGAGCAGGGC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.59

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTG-PGGVPVQG-SKYAADRNHYRRYPRRRG-PPRNYQQNYQNSESGEKNEGSES
T.EDV.V.............L.S.GDGETV.FD..EG..G....NVTG.PG...V...SK.AA......R....RG.PP...QQ..QNSES..KN.GSE.
Retrocopy
TREDVLVPRPPQRRKSSGD-LHSAGDGETVQFDAAEGD-GGRGPNVTG/PGRASVHT/SKCAAPWGQHSRCSSQRG/PPHTLQQIHQNSES-MKNVGSER


Parental protein
APEGQAQQRRPY-RRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQ-GAGEQGRPV-RQNMYRG-YRPRFRRG-PPRQRQP-REDGNEEDKENQGDE
AP.GQA.......RR.R.PP.YM.RPYG..PQ.S.PPVQ.EVMEG.D.Q..AGEQGRPV.RQ..YRG.YRP..RRG.PP.QRQP.REDG.....E..G.E
Retrocopy
APKGQAPCQPDH\RRPRSPPHYMWRPYG*QPQCSSPPVQREVMEGTDSQ/DAGEQGRPV/RQKLYRG/YRPQCRRG/PPHQRQP/REDG-QAYQEDRGQE


Parental protein
TQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADP-PAENSSAPEAEQG
T...QPP.R..RR.FN.R.R..E.P.PQDG.ETKAADP.PAEN.....AEQG
Retrocopy
TYYKQPP*RQHRRTFNDRHRGQEIPRPQDGQETKAADP/PAENPPL-RAEQG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide