RetrogeneDB ID:
retro_ecab_967
Organism:
Horse ( Equus_caballus )
Location:
8:24456221-24456550 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.83 %
Coverage:
67.27 %
Frameshifts:
4
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_967
GGTCTGAGGACAGCAGCGAAACTGACCATTCAGAACAGACAGGCCCAGACTGAGGGGGTA
GCTTCCGCCTCTGCCCTGATCATCGAAGTCCTCGAGGAATGCCAGGAGACAGAAAGAAGT
AGAAAAGCATCAAGCACAGGGCAAGTGTCACCTTTGATGAGATTGTCAACATTGGCCAAC
AGATGCAGCACCAGTCTTTGGCCAGAGAACTCTCTGGAACCGTTAAGAGGTCTGGGGACT
GCCCAGTCTGTGGACTGTAATGTTGATGCTGCCACCATCACGACATCTTAGACGACATCA
ACCCTGGTGCAGTGGAATGCACAGCCACC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.35
SRP021940_cerebellum 0.0
SRP021940_embryo 0.1
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.34
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GLRITVKLTIQNRQAQIEVVPSASALIIKALKE-PPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIK-EILG-TAQSVGCNVDGR-HPHD
GLR...KLTIQNRQAQ.E.V.SASALII..L.E..P.DRKK.K.IKH....TFDEIVNI..QM.H.SLARELSGT.K.E..G.TAQSV.CNVD...H.HD
Retrocopy
GLRTAAKLTIQNRQAQTEGVASASALIIEVLEE/MPGDRKK*KSIKHRASVTFDEIVNIGQQMQHQSLARELSGTVK/EVWG/TAQSVDCNVDAA/HHHD


Parental protein
VIDDINNGAVECPAS
..DDIN.GAVEC.A.
Retrocopy
ILDDINPGAVECTAT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide