RetrogeneDB ID:
retro_ecab_971
Organism:
Horse ( Equus_caballus )
Location:
8:40518086-40518541 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.24 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
PLP2
Parental gene aliases:
No gene alias available
Parental gene description:
proteolipid protein 2 (colonic epithelium-enriched) [Source:HGNC Symbol;Acc:9087]

Genomic region (view in browser)





>retro_ecab_971
ATGGCGGATTCCGAGCTTCGCTCGGCCCCCGGCTGCTGCGTCCACTGCACCAACTTCTTG
CGCAGCCGAAAGGGAATTCTCCTGTTTGCTGAGATTATATTTTGCCTGATGATTGTGATC
TGCTTCAGTGTCTCAGCACCAAAATACTCCAGCCTGTCGGTGGTGGAGCTGATCCTTGCT
GTTTTCTTTTTTGTCATCTACATGTGTGACCTGCACCCCAAGATACGATTCATCAACTGG
CCTTGGAGTGATTTCTTCCGAACCTTCATAGCAGCGATCCTCTATCTGACCACCTCCATT
ATTGTCCTTGTTCAGAGAGGACACCGCTCCAAAATCACCGCAGGGGCACTGGGCTTAGTT
GCCACGTGCCTCTTTGGCTATGATGCCTATGTCACCTTACCCTGGGAGAAATAAAGACAT
ATAGTAGCCTCTACTGAACCGCAGATGGCCCGGTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.1
SRP021940_embryo 0.19
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 53.46

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MADSERLSAPGCWTACTNFWRTRKGILLFAEIVLCLVILICFSASTSAYSSLSVIEMILAAIFFVIYMCDLHNKIQIINWPWSDFFRTLIAAILYLITSI
MADSE..SAPGC...CTNF.R.RKGILLFAEI..CL.I.ICFS.S...YSSLSV.E.ILA..FFVIYMCDLH.KI..INWPWSDFFRT.IAAILYL.TSI
Retrocopy
MADSELRSAPGCCVHCTNFLRSRKGILLFAEIIFCLMIVICFSVSAPKYSSLSVVELILAVFFFVIYMCDLHPKIRFINWPWSDFFRTFIAAILYLTTSI


Parental protein
VVLVNERNHSRITAGVLGLIATCLFGYDAYTTFPLRQQRHSAAPTDP-ADGPV
.VLV.....S.ITAG.LGL.ATCLFGYDAY.T.P....RH..A.T.P.ADGPV
Retrocopy
IVLVQRGHRSKITAGALGLVATCLFGYDAYVTLPWEK*RHIVASTEP/ADGPV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide