RetrogeneDB ID:
retro_ecab_976
Organism:
Horse ( Equus_caballus )
Location:
8:65774148-65774523 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.43 %
Coverage:
91.97 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS25
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S25 [Source:HGNC Symbol;Acc:10413]

Genomic region (view in browser)





>retro_ecab_976
GGCCGCAGTGGTCCCAGCTGCTGTCTGAGCTTCACGATGCCACCCAAGGACAAGAAGAAG
AACATAAATGCCAGAAAGCTGGCCAAGAAAGATAAAGACCACGCGAAGACATCCTGGGGT
AAGGGCAAAAAGAAGTGGTCCAAAGCCAAAGTTTGAGACAAGCTCAATAACCTAGTCTTG
TTTGACAAAGCCTCATATGCAAAACTCTGTAAGGAAGTTCCTAACTATAGGTTTATAACC
TCAGCTGTTGTCTCTAAGAGACTGAAGATTCCCAGTTCCCTGACAAGGGTAGCCCTTCAG
GAGCTCCTTAGTGAAGGACTCATTAAAGTGGTTTCAAAGCACAGAGTTCAGATAATTTAC
ACCAGAAGGGCAGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.25
SRP021940_embryo 0.48
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.29
SRP021940_testis 2.25

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GCSGDSCCPSFAMPPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAAL
G.SG.SCC.SF.MPPKD.KK...A.K.AKKDKD....S.GK.KKK.WSK.KV.DKLNNLVLFDKA.Y.KLCKEVPNY..IT.AVVS.RLKI..SL.R.AL
Retrocopy
GRSGPSCCLSFTMPPKDKKKNINARKLAKKDKDHAKTSWGKGKKK-WSKAKV*DKLNNLVLFDKASYAKLCKEVPNYRFITSAVVSKRLKIPSSLTRVAL


Parental protein
QELLSKGLIKLVSKHRAQVIYTRNTK
QELLS.GLIK.VSKHR.Q.IYTR...
Retrocopy
QELLSEGLIKVVSKHRVQIIYTRRAE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide