RetrogeneDB ID:
retro_ecab_981
Organism:
Horse ( Equus_caballus )
Location:
8:83178973-83179964 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.76 %
Coverage:
68.45 %
Frameshifts:
8
Stop codons:
6


Parental gene:
Parental gene symbol:
KPNA7
Parental gene aliases:
No gene alias available
Parental gene description:
karyopherin alpha 7 (importin alpha 8) [Source:HGNC Symbol;Acc:21839]

Genomic region (view in browser)





>retro_ecab_981
AGGCTGAGGAAATTTCAGTACTGAGGCAAAGAAGCATCTACGAGGCAGCAACAGCAGATG
GCAATCAGCCTACAGCTCCAGAAAGCCAAGAAAGACGAGCAGGCTGTAAAGAGAAGGAAC
ATGACCAATCTCTCACCTGACTCAGTTTCAGGAAAGCTCACCAAATTGGTCAGCTTCCCC
CTGCATGAAATAATCAATGGTGTGACTCCTCGGACCCAGAGCTATGTGTCCAGGCCACTC
AGGCAGCCAGGAAAATGCTGTCTCAAGAAAGAAGCCCTCCTCTAAAATAGATTGTTGAAG
CAAGGCTCGTTCTCATGCTGCTGGAGCTCCTGAAGTCATGGCTTCACCACTGCTTGCGGT
TGAGGCAGCCTGGGCTCTGACCAGCACAGCTTCATTGACTTTGGAGCAGACACCAGCTGT
TGTGGACGGAGTGCCATCCAGCCCTTGAGTGAGCTTCTGTCTTCCCCTGGTGTGACTGTT
TGTGAACAGGTAATGTGGGTTCTTGGTAACAGAGCAGGTGACAGCTGAGAATTCAGAGAC
ATCGTCCTCTTGAGCAATGCTGTCCCACATCTGCTGGCCCTGGTTTTTCATCAACCATAC
CCATCCCATTTCTGTAGAACATCATGTGGACCTTGTCCACACTGGAGCAAAACAACAACC
GGTACTCTTGTGAAAAAGTGGTCAAGTAAATGTTGTTACTCCTCTTCCACCTCCCACAGC
GTCGTGGCAATGAGGTTCCCTGGGACACCTGCTGGGCCATGTCCTACCTCATGATGGCTG
CAATGAGTGCATCTGCCAAACGGTTGACAAGGGGGTCCTGTCTGGCTGCTAGAGCTCATG
ACCAGTTTGAGGCTCAATGTCTTGACCCCCTCTCTCCACACTGTGGAAACTTCGTCATTG
TAACGGATCACCAGAACTAAGTGGCCGTTGACACAGGCGGCTGAGCATGCTGCCCCAGCT
CCTGATGCACCGCAAGTTCTCCATCCAGAGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.1
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.29
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RLRKFKYRGKDTAVRRQQRIAVSLELRKAKKDEQALKRRNITPLSPDPASEQQTKAINLTLQEIINGV-NASDPDLCFQATQAARKMLSRERNPPLKLII
RLRKF.Y.GK....R.QQ..A.SL.L.KAKKDEQA.KRRN.T.LSPD..S...TK.....L.EIINGV...SDP.LC.QATQAARKMLS.ER.PPLK.I.
Retrocopy
RLRKFQY*GKEASTRQQQQMAISLQLQKAKKDEQAVKRRNMTNLSPDSVSGKLTKLVSFPLHEIINGV/DSSDPELCVQATQAARKMLSQERSPPLK*IV


Parental protein
EAGLIPRLVEFLKSSLHPCLQF-EAAWALTNIASGTSEQTRAVVEG-GAIQPLVELLSSPHMTVCEQAVWALGNIAGDGPEFRDIVISSNVIPQLRALI-
EA.L...L.E.LKS.LH.CL...EAAWALT..AS.T.EQT.AVV.G..AIQPL.ELLSSP..TVCEQ..W.LGN.AGD..EFRDIV..SN..P.L.AL..
Retrocopy
EARLVLMLLELLKSWLHHCLRL/EAAWALTSTASLTLEQTPAVVDG/SAIQPLSELLSSPGVTVCEQVMWVLGNRAGDS*EFRDIVLLSNAVPHLLALV/


Parental protein
SSTT-PITFLRNITWTLSNLCRNKNPYPCERAVKQMLPVLSRLLQHQDSEVLSDACWALSYLT-DGCNDRIGQVVDIGVLPR-LVELMTSSELNVLTPSL
.S.T.PI.FL.NI.WTLS.L..N.N.Y.CE..VK.ML..L..L.Q....EV..D.CWA.SYL..DGCN..I.Q.VD.GVL...L.ELMTS..LNVLTPSL
Retrocopy
FSSTIPIPFL*NIMWTLSTLEQNNNRYSCEKVVK*MLLLLFHLPQRRGNEVPWDTCWAMSYLM/DGCNECICQTVDKGVLSG/LLELMTSLRLNVLTPSL


Parental protein
RTV-GNVVTGTDHQTQVAIDAG-MLSVLPQLLMHPKASIQK
.TV.GN.V..TDHQ..VA.D.G..LS.LPQLLMH.K.SIQ.
Retrocopy
HTV/GNFVIVTDHQN*VAVDTG/RLSMLPQLLMHRKFSIQR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide