RetrogeneDB ID:
retro_ecab_985
Organism:
Horse ( Equus_caballus )
Location:
8:11139930-11140366 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.0 %
Coverage:
54.28 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_ecab_985
AATAAATGTGCAGCAGCCTGGGACCATCATAGACACTGTTCACGTCACAGGGGTCCTCCA
CACACCCACCAGCAGAACTACCAGAATAGTGAGAGCGAGAAAAAACGAGGGATCAGAGAA
TGCTCCTGAAGGCCAGGCCCCACAGTGCCAACCTGACCACATGCGGGCCTTGGTCCCCAC
CTTACTACATGCAGAGACGCTATGGGTGACAAGCACAGTGTTCCAGCCCTCCTGTGTAGG
GAGAAGTGATGGAGGGGACTGACAACCAGGGTGCAGGAGAACAAGGCAGACCAGTGAGAC
AGAAGCTGTATCGGGGTATAGACCACAATTCCGCAGGAGCCCTCCTCGCCAAAGACGGCC
CAGAGAAGGTGGTCATGGAGGTCAGGAAAACCAAGGAGATGAGACCTAATGTAAGCAGTC
ACCTCAACATGAGCAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEK-NEGSESAPEGQAQQRRP-YRRRRFP-PYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRP
.K.AA...H.R...R.RGPP...QQNYQNSES.EK.NEGSE.APEGQA.Q..P...R...P.PYYM.R.YG...Q.S.PPV.GEVMEG.DNQGAGEQGRP
Retrocopy
NKCAAAWDHHRHCSRHRGPPHTHQQNYQNSES-EK\NEGSENAPEGQAPQCQPDHMRALVP\PYYMQRRYG*QAQCSSPPV*GEVMEGTDNQGAGEQGRP


Parental protein
VRQNMYR-GYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRY
VRQ..YR.GYRP.FRR.PPRQR.PRE.G.....ENQGDET...Q.PQ...
Retrocopy
VRQKLYR/GYRPQFRRSPPRQRRPRE-GGHGGQENQGDET*CKQSPQHEH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide