RetrogeneDB ID:
retro_ecab_986
Organism:
Horse ( Equus_caballus )
Location:
8:18497389-18497705 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.39 %
Coverage:
71.33 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
GNB2L1
Parental gene aliases:
No gene alias available
Parental gene description:
guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 [Source:RefSeq peptide;Acc:NP_001229375]

Genomic region (view in browser)





>retro_ecab_986
AAAACCGTCAAGCTATGGAATTTTCTGGGTGTATGCAAATACACTGTCCAGGATGAGAGC
CACTCGGGTGGGTGTCTCGTGTCTACTTCTCACCCAAAAGCAATCCCATCGCTGTCTCGT
GGGGCCGGGACAAGCTGGTCAAGGTAGAAAACTTGCAAACTGCAAGTTGAAGACCAGTCT
CATGGGCCACACGGGCTACCCGGACACTGTGACTGTCTCTCCAGATGCATCCCTCCACAC
TTCTGGAGGCAGGGAGGGGCAGGCCATACTGCAGGGCCTCAGTGAAGACAAGCACCTGTA
CACGCTAGATGATGGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KTIKLWNTLGVCKYTVQDESHSE-WVSCVRFSPNSSNPIIVSCGWDKLVKVWN-LANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEG
KT.KLWN.LGVCKYTVQDESHS..WVS.V.FSP.S.NPI.VS.G.DKLVKV.N.LANCKLKT...GHTGY..TVTVSPD.SL..SGG..GQA.L..L.E.
Retrocopy
KTVKLWNFLGVCKYTVQDESHSG/WVSRVYFSPKS-NPIAVSWGRDKLVKVEN/LANCKLKTSLMGHTGYPDTVTVSPDASLHTSGGREGQAILQGLSED


Parental protein
KHLYTLDGG
KHLYTLD.G
Retrocopy
KHLYTLDDG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide