RetrogeneDB ID:
retro_ecab_987
Organism:
Horse ( Equus_caballus )
Location:
8:23792534-23792849 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.27 %
Coverage:
96.4 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
SKA2
Parental gene aliases:
No gene alias available
Parental gene description:
spindle and kinetochore associated complex subunit 2 [Source:HGNC Symbol;Acc:28006]

Genomic region (view in browser)





>retro_ecab_987
ATGTTCCAGAAAGCCGACTCTGATCTGGATACACTCAGGACAGGGTGGATATGAAATCAA
CACTAATCACCCTGATTTGGCAGGGGAGAAACATCCAATTACACTCCTAAAGGAATCAGC
AGCCAAAAGCCTCGATGTCAGACTTTGCACACACGTGTGAAGCCAGCTGCTGCTGAGCAG
AAAGGCTGAGCGCCTCATCAGTGCTCTTCTGAATGAGACTATGACCGGGACACAAGAACC
ACACAGACACACAGACCTGGAACTGGCACCACTGACTGAAGAAGAGAAGACCGCCCCAGA
GCAACTAAATCTCAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.34
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.18
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MFQKADSDLD-YIQYRLE-YEIKTNHPDSAGEKNPVTLLKELSAIKSRYQTLQARFKPVAIEQKETKSRICATFNKTMAMIQELQKQTDLELSPLTEEEK
MFQKADSDLD.Y.Q.R...YEI.TNHPD.AGEK.P.TLLKE.SA.KS....L.................I.A..N.TM...QE....TDLEL.PLTEEEK
Retrocopy
MFQKADSDLD/YTQDRVD/YEINTNHPDLAGEKHPITLLKE-SAAKSLDVRLCTHV*SQLLLSRKAERLISALLNETMTGTQEPHRHTDLELAPLTEEEK


Parental protein
TAAEQL-KSH
TA.EQL.KSH
Retrocopy
TAPEQL/KSH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide