RetrogeneDB ID:
retro_ecab_988
Organism:
Horse ( Equus_caballus )
Location:
8:26013034-26013363 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.04 %
Coverage:
50.93 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
FGFR1OP2
Parental gene aliases:
No gene alias available
Parental gene description:
FGFR1 oncogene partner 2 [Source:HGNC Symbol;Acc:23098]

Genomic region (view in browser)





>retro_ecab_988
AAAATGAATTGCACAATTGAGAGAGCATTGGTCGATGCTAAAGTTCTCATTGAAAGATTG
GGAGATTATGACAGTGCAGCAGAATCTCGTACTGAGCAAACTGTACCTCTCACCCAGCAC
GCAGAAGCCATCAAGTAGCATCAGGAAAAAACCCAGAATCTAATGACTTTGCATGTCCAC
CATGGCCTACGTTAATTAAGGGCATCCAGCAAGAAAACTGACAGATCAGAGCACTGCAAT
ATGACAACAAATAATTCCGTACATCCTGGGAGAAACACCAGTGAGCGCTGGGACTTAGAA
TGAACAAGTACCAAGAGCAAATATTTAGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EMSCTIEKALADAKALVERLRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQ-ELNEVARHRPRSTLVMGIQQENRQIRELQQENK-LRTSLEEHQSALE
.M.CTIE.AL.DAK.L.ERL.D.D.AAES..EQT..L....EA.K..QE..Q.E.N..A...P..TL..GIQQEN.QIR.LQ..NK..RTS.E.HQ.AL.
Retrocopy
KMNCTIERALVDAKVLIERLGDYDSAAESRTEQTVPLTQHAEAIK*HQEKTQ/ESNDFACP-PWPTLIKGIQQEN*QIRALQYDNK*FRTSWEKHQ*ALG


Parental protein
LIMSKYREQMFR
L.M.KY.EQ.FR
Retrocopy
LRMNKYQEQIFR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide