RetrogeneDB ID:
retro_ecab_991
Organism:
Horse ( Equus_caballus )
Location:
8:38123361-38123959 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
87.0 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
CHMP1B
Parental gene aliases:
No gene alias available
Parental gene description:
charged multivesicular body protein 1B [Source:HGNC Symbol;Acc:24287]

Genomic region (view in browser)





>retro_ecab_991
ATGTCCAACATGGAGAAACACCTGTTCAAACCTGAAGTTCGCGGCCAAAGAACTGAGCAG
GAGTGCCAAAAAATGCGACAAGGAGGAAAAGGCCGAAAAGGCCAAAATTAAAAAGGCCAT
TCAGAAGGGCAACATGGAAGTTGCGAGGATTCACGCCGAAAATGCCATTCGCCAGAAGAA
CCAGGCGGTGAATTTCTTGAGAATGAGTGCGCGGGTTGATGCTGTGGCTGCCAGAGTCCA
GACGGCGGTGACGATGGGCAAGGTGACCAAGTCGATGGCCGGTGTGGTTAAGTCGATGGA
TGCGACGCTGAAGACCATGAATCTGGAGAAGATCTCTGCCTTAATGGACAAATTCGAGCA
CCAGTTTGAGACGCTGGATGTCCAGACGCAGCAAATGGAAGACACGATGAGCAGCACGAC
GACGCTGACCACTCCCCAGAACCAAGTGGATATGCTGCTCCAGGAAATGGCAGACGAGGC
CGGCCTAGACCTCAACATGGAGCTGCCGCAGGGGCAGACCGGCTCCGTGGCTACGAGCGT
GGCTTCGGCCGAGCAGGATGAACTATCCCAGAGACTGGCCCGCCTGCGGGATCAAGTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 16.03
SRP021940_cerebellum 20.61
SRP021940_embryo 24.24
SRP021940_placental_villous 25.49
SRP021940_synovial_membrane 15.24
SRP021940_testis 10.56

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSNMEKHLF-NLKFAAKELNRNAKKCDKEEKAEKAKIKKAIQKGNTEVARIHAENAIRQKNQAINFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSM
MSNMEKHLF.NLKFAAKEL.R.A.................IQKGN.EVARIHAENAIRQKNQA.NFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSM
Retrocopy
MSNMEKHLF\NLKFAAKELSRSAXXXXXXXXXXXXXXXXXIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSM


Parental protein
DATLRSMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASTEQDELSQRLARLRDQV
DATL..MNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSV.TSVAS.EQDELSQRLARLRDQV
Retrocopy
DATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVATSVASAEQDELSQRLARLRDQV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide