RetrogeneDB ID:
retro_ecab_992
Organism:
Horse ( Equus_caballus )
Location:
8:39828225-39829026 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.19 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_ecab_992
GCAACGAAGGTTTTGGGAACAGTGAGATGGTTCAATGTAAGAAACGGATATGGTTTCATC
AACAGGAATGACACCACGGAAGATGTATTTGTACAGCAGACTGCCGTAAAGAAGAATAAC
CCCAGGAAGTACCTTCGCAGTGTAGGAGATGGAAAGACTGTGGAGTTTGATGTTGTTGAA
GGAGAAAAGGGTGCGGAGGCAGCAAATGTTACAGGCCCTGGTGGAGTTCCAGTGCAAGGC
AGTAAATATGCAGCAGACCGTAACCATTATAGACGCTATCCACGTCGCAGGGGTCCTCCA
CGCAATTACCAGCAGAATTACCAGAATAGTGAGAGTGGGGAAAAGAATGAGGGATCGGAG
AGCGCTCCCGAAGGCCAGGCCCAACAGCGGTGGCCCTACCACAGGCAACGGTTCCCACCT
TACTACATGCGGAGACTCTATGGGCGTCGACCACAGTATTCCAACCCTCCCATGCAAGAA
GTGATGGAGGGTGCTGACAACCAGGGTGCAGGAGAACAAGGTAGACCAGTGAGGCAGAAT
ATGTATCGGGGTTATAGACCACGATTCCGCAGGGGCACTCCTGGCCAAAGACAGCCCAGA
GAGGCTGGCAATGAAGATAAGGAAAATCAAGGAGATGAGACCCAAGGTCAGCAGTCACCT
CAACGTTGGCACCGCCGCAACTTCAATTACCGACGCAGACGCCCAGAAAACCCTAAACCA
CAAGATGGCAAAGAGACAAATGCAGCCGATCCACCAGTTGAGAATTCGTCCGCTCCCCAG
GCTGAGCAGGGTGGGGCTGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 4.47
SRP021940_cerebellum 2.09
SRP021940_embryo 7.07
SRP021940_placental_villous 2.28
SRP021940_synovial_membrane 3.15
SRP021940_testis 23.79

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPP
ATKVLGTV.WFNVRNGYGFINRNDT.EDVFV.QTA.KKNNPRKYLRSVGDG.TVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPP
Retrocopy
ATKVLGTVRWFNVRNGYGFINRNDTTEDVFVQQTAVKKNNPRKYLRSVGDGKTVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPP


Parental protein
RNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQP
RNYQQNYQNSESGEKNEGSESAPEGQAQQR.PY.R.RFPPYYMRR.YGRRPQYSNPP.Q.EVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRG.P.QRQP
Retrocopy
RNYQQNYQNSESGEKNEGSESAPEGQAQQRWPYHRQRFPPYYMRRLYGRRPQYSNPPMQ-EVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGTPGQRQP


Parental protein
REDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
RE.GN.EDKENQGDETQGQQ.PQR..RRNFNYRRRRPENPKPQDGKET.AADPP.ENSSAP.AEQGGAE
Retrocopy
REAGN-EDKENQGDETQGQQSPQRWHRRNFNYRRRRPENPKPQDGKETNAADPPVENSSAPQAEQGGAE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide