RetrogeneDB ID:
retro_ecab_994
Organism:
Horse ( Equus_caballus )
Location:
8:42982118-42982720 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.51 %
Coverage:
56.99 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
ACTB
Parental gene aliases:
No gene alias available
Parental gene description:
actin, cytoplasmic 1 [Source:RefSeq peptide;Acc:NP_001075307]

Genomic region (view in browser)





>retro_ecab_994
ATCCACAATGGCTCTGGCATGTGCAAAGCTGGCTTTTCTGGGGATGATGCCCCACAGCCA
TGTTGGGTGCCCTGGCACCAGGGTATCATGGTGGGCATGGGGCAGGAAAGCTATATGGGT
GGCAATGCCCCGAGCAAGCACAGCATCCAGACACTGAAGTCCCCCATGGAGCAGACACTG
TCACCAACTCGGACGACATGGGGAAGATCTGGCACCTCTACAACGAGCTGCACCGTTGCC
CTGGAGGGGCATGCTGACCTGCTGACTGAGGCCTTCCTGAACCTCAAGGCCAATAGAGAA
AAGATGACTTAGATCATGTCTGAGACCTTCAACACCCGGGCCTTGTACGTGGCAATCTAG
GCCATGTTGGCCCTGTATGCTTCTGGCTACCCCACTGGTATTGTCACGGACCCCAGGGAT
GGGGTCACCCACATGGTGCCCATCACCAGGGTTATGCCCTGCCCCACACTATCCTGAGTC
GGGACCTGGCTAGCTGGTACCTGATTGATTAACTCATGAAGATCCTCACAGAGAGTGGCT
ACAGCTTCACCACCCCCACCAAGGGGAAAATCGTGAGTGACATCAAGGGGAAGCTCTGCT
AC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VDNGSGMCKGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI-VTNWDDMEKIWHHTFYNELR-VAPEEHPVLLTEA
..NGSGMCK..AG.....A..P..V..P.HQG.MVGMGQ..SY.G..A.SK..I.TLK.P.E....VTN.DDM.KIWH...YNEL..VA.E.H..LLTEA
Retrocopy
IHNGSGMCK--AGFSGDDAPQPCWV--PWHQGIMVGMGQ-ESYMGGNAPSKHSIQTLKSPMEQTL/VTNSDDMGKIWH--LYNELH\VALEGHADLLTEA


Parental protein
PLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPI-YEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAERE
.LN.KANREKMT.IM.ETFNT.A.YVAI.A.L.LYASG..TGIV.D..DGVTH.VPI...GYALPH.IL..DLA...L.D.LMKILTE.GYSFTT.....
Retrocopy
FLNLKANREKMT*IMSETFNTRALYVAI*AMLALYASGYPTGIVTDPRDGVTHMVPI/HQGYALPHTILSRDLASWYLID*LMKILTESGYSFTTPTKGK


Parental protein
IVRDIKEKLCY
IV.DIK.KLCY
Retrocopy
IVSDIKGKLCY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide