RetrogeneDB ID:
retro_ecab_995
Organism:
Horse ( Equus_caballus )
Location:
8:44224434-44224643 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.83 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
TMEM167A
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 167A [Source:HGNC Symbol;Acc:28330]

Genomic region (view in browser)





>retro_ecab_995
TCTGCCATTTTCAATTTTCAGAGTCTGTTGACTATAATCTTGCTGTTTATAAGTTCCTGT
GCTTATATCCAATCCTTGGCACCCAGCCTCCTGGACAGAAAACTGGATTTGGGGGTATAT
TTTGGAAGTGTGCCAGAATTGGCAAACAGAAGAGTCCTTATGTTGCAATATGCTGTATAA
TCATGGCCTTCAGCATCCTCTTCATACAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.05
SRP021940_embryo 0.31
SRP021940_placental_villous 0.72
SRP021940_synovial_membrane 0.36
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGER-KSPYVAICCIVMAFSILFIQ
SAIFNFQSLLT.ILL.I..CAYI.SLAPSLLDR.K..L...F........R.KSPYVAICCI.MAFSILFIQ
Retrocopy
SAIFNFQSLLTIILLFISSCAYIQSLAPSLLDR-KLDLGVYFGSVPELANR/KSPYVAICCIIMAFSILFIQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide