RetrogeneDB ID:
retro_ecab_997
Organism:
Horse ( Equus_caballus )
Location:
8:51653862-51655594 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.88 %
Coverage:
99.14 %
Frameshifts:
4
Stop codons:
9


Parental gene:
Parental gene symbol:
ARHGAP42
Parental gene aliases:
No gene alias available
Parental gene description:
Rho GTPase activating protein 42 [Source:HGNC Symbol;Acc:26545]

Genomic region (view in browser)





>retro_ecab_997
CAAAGGATGAAATCTGCCAGCCAAGATTCCAGACCCCCCAGCCAGGGAATGATGGAAGGC
TATCTTTACATCCAGGAGAAATGACCGCTTCATTTTACATGGATTAAACATTATTGTACA
CACGATAAGGGAGGTAAAACATTTACAAAGAGCATTTCAGAAATGCAATCCAGTGGGGAA
GTGAATGGCCTTATTACCAGCTCACCAGAAATGTCTAAATTAAAGTCTGGTATCCAACTA
AGGACAGACTCAATTGACAAATGATTCTGCTTTGACATGGAAGTAGTTGACAGGCATGGG
AGCACCACATTGCAGGCCGTCTCAGAAGCTAATCGGAAATCCTGGCTTAAAGTCATGGAT
GGGAAGGAATTGATTCACACCCTGCCTGCCATTACCAGCAAGAAAGAAGAAATGTACCTA
AATGAAGCAGGGTTCAACTTTGTAAGAAAATGCATTCAAGCTGTGGAAACAAGAGGCATC
ACCGTTTTAGGCCTGTAACGAATAGGAGGCGTGAACTCCGAAGTTCAGAGACTCACGAAT
ACCACATCTTCTTCAAAATCCCCTCCTGATATTGACATTGATATTGAACTATGAGATAAT
AAGACAATAACAAGTCGGCTGAAAAATGACCTCAGGTGCCTTGCATAACCACTGATGACT
TACAACTTACACAAAGATTTGATTGTTGCTGTTAACTCCGATGACCAGAACTTCCAGGTG
GATGCATTGGTGCACAATTGCCAGAGAAAAACAGAGAGATGCTGGAAATCTTAATAAAGC
ACCTGGTCAAAGTATCACTACACAGCCAATAAAATCTTATGACTGTCTCAAACCTTGGTT
TCACATTCGGCCCAACTCTAATTGAGAGCACAGGAAGAAACTGTGGCTGCCATAATGAAT
ATTAAATGTCAGAATATGGTGGTTGAAATTCTGGTAGAACACTATGAAAAGATTTTTCAT
ACTGCCGCAGACCCAAGCATTGCTCTTCCTCAGCTTCAGTCTTGATATGCATCCTGAAGG
ACAGGAGCAGCCTGCCTCTCCACAGGCTCCCGGAAGCCCAGAAGGAGGTATACTCCATGC
CTGGCAGAACACTATAGGGACTCCTATAGCGGCAGCCCAGACAGCACACCCACAGGGAGC
GAATCACTCTTCTCTCACTCCTCCGAACAAAACAGCACTACAATGTCAGCTTCCTGCCAG
CCCAGGGAAAAATCTGGAGGGATTCCGTCATTGCATCCCCATCACCTCCCAATGGACGGA
AGAGTCTTGGTCTGTGGACTAGTCCTGAATCAAGTTCTAGAGCAGATGTAACCAAAACAG
ATGCAGAATCAGATTACCATACGGTTGCCTCCCTCACTAGCCCAGGATATGTTTCCCCAC
CCACAGACCTGACCAAGAAAGGGCCCTATGGACTTTCAGGACCGAAAAGAGCCTCAGCTT
CCTCTCTCTGATCCCTCTCTGCTGCTAAAGGAAGCAAGAGCTACAGTGGATCCATTCAAA
GCTTAACTTCCATAGGTTCCAAAGAGACACCCAAAGCCCCACCAAACCCAGGCCAGCCTC
CAAAAATGTGCGGGAGATTAAAGCTAAACACTGTCTTAAGCAATGGCTACCAGCGCCTTG
GCTCCATTGTAGCAACGAAAGCGCAACTCTTTGAAACAGTGGTTCCCTTCAGCCAGTTTC
TTCCGGGCGGCGGCAAGTGAAAGCCACGTACGCCTGCAAAGCAGAGCACAGC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QRMKSANQDYRPPSQWTMEGYLYVQEKRPLGFTWIKHYCTYDKGSKTFTMSVSEMKSSGKMNGLVTSSPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHG
QRMKSA.QD.RPPSQ..MEGYLY.QEK.PL.FTWIKHYCT.DKG.KTFT.S.SEM.SSG..NGL.TSSPEM.KLKS.I...TDSIDK.FCFD.EVV.RHG
Retrocopy
QRMKSASQDSRPPSQGMMEGYLYIQEK*PLHFTWIKHYCTHDKGGKTFTKSISEMQSSGEVNGLITSSPEMSKLKSGIQLRTDSIDK*FCFDMEVVDRHG


Parental protein
IITLQAFSEANRKLWLEAMDGKEPIYTLPAIISKKEEMYLNEAGFNFVRKCIQAVETRGINILGLYRIGGVNSKVQKLMNTTFSPKSPPDIDIDIELWDN
..TLQA.SEANRK.WL..MDGKE.I.TLPAI.SKKEEMYLNEAGFNFVRKCIQAVETRGI..LGL.RIGGVNS.VQ.L.NTT.S.KSPPDIDIDIEL.DN
Retrocopy
STTLQAVSEANRKSWLKVMDGKELIHTLPAITSKKEEMYLNEAGFNFVRKCIQAVETRGITVLGL*RIGGVNSEVQRLTNTTSSSKSPPDIDIDIEL*DN


Parental protein
KTITSGLKNYLRCLAEPLMTYKLHKDFIVAVKSDDQNYRVEAVHALVH-KLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTL-MRAQEETV
KTITS.LKN.LRCLA.PLMTY.LHKD.IVAV.SDDQN..V.A...LVH..LPEKNREML.ILIKHLVKVSLHSQ.NLMTVSNLG..FGPTL..RAQEETV
Retrocopy
KTITSRLKNDLRCLA*PLMTYNLHKDLIVAVNSDDQNFQVDA---LVH/QLPEKNREMLEILIKHLVKVSLHSQ*NLMTVSNLGFTFGPTL\LRAQEETV


Parental protein
AAMMNIKFQNIVVEILIEHYEKIFHTAPDPSIPLPQPQSRSGSRRTRAICLSTGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTT
AA.MNIK.QN.VVEIL.EHYEKIFHTA.DPSI.LPQ.QS...S.RT.A.CLSTGSRKPR.RYTPCLAE...DSYS.SPDSTP.GS.ESL.SHSSEQNSTT
Retrocopy
AAIMNIKCQNMVVEILVEHYEKIFHTAADPSIALPQLQS*YAS*RTGAACLSTGSRKPRRRYTPCLAEHYRDSYSGSPDSTPTGS-ESLFSHSSEQNSTT


Parental protein
KSASCQPREKSGGIP-WIASPSPSNGQKNLGLWTTSPESSSREDATKTDAESD----CQITSPGDTSPPIDLTKKGPYGLSGLKRASASSLRSISAAEGN
.SASCQPREKSGGIP..IASPSP.NG.K.LGLW.TSPESSSR.D.TKTDAESD.......TSPG..SPP.DLTKKGPYGLSG.KRASASSL.S.SAA.G.
Retrocopy
MSASCQPREKSGGIP/VIASPSPPNGRKSLGLW-TSPESSSRADVTKTDAESDYHTVASLTSPGYVSPPTDLTKKGPYGLSGPKRASASSL*SLSAAKGS


Parental protein
KSYSGSIQSLTSIGSKETPKAAPNPDLPPKMCRRLRLDTASSNGYQRPGSVVAAKAQLFE-NVGSLKPVSSG-RQAKAMYSCKAEHS
KSYSGSIQSLTSIGSKETPKA.PNP..PPKMC.RL.L.T..SNGYQR.GS.VA.KAQLFE.N.GSL.PVSSG.RQ.KA.Y.CKAEHS
Retrocopy
KSYSGSIQSLTSIGSKETPKAPPNPGQPPKMCGRLKLNTVLSNGYQRLGSIVATKAQLFE/NSGSLQPVSSGRRQVKATYACKAEHS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide