RetrogeneDB ID:
retro_mputfur_1
Organism:
Location:
GL896945.1:704137-705484 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
50.94 %
Coverage:
99.62 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
Fam47e
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 47, member E [Source:MGI Symbol;Acc:MGI:2686227]

Genomic region (view in browser)





>retro_mputfur_1
ATGGCAGACAAGAAGTGGCTGTTAGGGCCTGTGCCACTGGAACCAATGCCGCTGGGCATG
CACTGCAAGCCCTGGTACAAAGACAGGTTGCCCTCCAAGTGTTTCCCAAAGCACAAGAAC
AAGCTTCTGAAGTTCCCCACCTCCCTGGACAGTCGGCGGTGGGTATTTGTGAAAGAGGGG
CTGGACGACTTCAGGAGGGAATGTCCACCGTGTGAAGACCTGATCACTCGCAGTCCTAAA
GAAGGCTTTCTTCCCATGATTGTTCACAGAGTTCCCAAACCTGCCCCCACAAAGAAAAAG
CTGACCAAGGAAACGGACCTGTTGTCCACACTGTCGCCAGCCCAGCTAGCACGGAAGGCA
TTCGTAGAGGACATCGAAGCCCATCTGACAGAGCATCCCTTGGCTCTCTACCCAAATCTG
GAGAAAGATCTACCTTCAGACCTCTTATTAAAGGTGCTAGAAGTGCTCGATCCTGACAAG
AGGCTGAACGACACATGGGCCTATTGTCAGAACGCGGAGAAAAGAAGGAAGTCCCCCACA
AAGCTTAGAAAGAAACGTCCTGCCAAACTCAATCTGGAACTTCCCAAGAAGACTCCTGGG
TCACATCCAGACAAGTTGCCTCATGAAGAAAGGAAGTCAAGCATAAATGAAGATTTGCTC
AAAACTCCTCCCCTTCATAGAAAAATACCAAAAGGAGTCCGTAAATTCTGCAAATGGGTT
GCTACTTTTGGAGACTTGGGCATTGATGAAGAGTTCATCATGAAACAGTTTGACATTGGC
TATGAATGCAAACCAACCTATGACAGGAGCCACACAAAGAAAGTAAACCATGTTCCTTTG
GACCTAAAGTACAGAAAGGGGCGAGATAAAATGGATGATATAAAATTCTCCATATACTGG
GAAAACTGGGAGAGGAAACTCCAAAAACCAAAGAATCCTTATAAACCCAACTGGGTGAAG
GTGAGGTACGGAGCATGGTACCTGAAGCCCAAGTTGTGGAAAAAGCTAATAAATGATGAA
CCTTTGATTGATCCCAAGGTTTTACATGAAGCTCCAGATGGAAGATATGGAAGGAATTTT
CCTCAAAAGGATATTCTTGAAGAACTTTATGGAACAATTGCTTTTAAAGATTTCATTCTA
AGCAAGGGCTACAGGATGCCAGGCTTCCTTGAGAAGTTGTTTCTCAGGAAGGGATGGAAA
TATGATTCTGTTAGGACTCCTATACATCAAGTAATAAATATAAGCACAAATGTAGAAGAA
GAAGAAGAACAAGAAGAAGAAAAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAA
GACGACGACGCACATGAAGATGTTTAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPVELLFKVLDVLDPDRKLEDTWAYCQGVRKRAKEPAKLLRKKLSTQDDPGLPKKTAVSHPGQWLHEEKKPHQTDLLREDGPLIHENVRKGVRDFCNWAT
.P..LL.KVL.VLDPD..L.DTWAYCQ...KR.K.P.KL.RKK........LPKKT..SHP....HEE.K......L....PL.H....KGVR.FC.W..
Retrocopy
LPSDLLLKVLEVLDPDKRLNDTWAYCQNAEKRRKSPTKL-RKKRPAKLNLELPKKTPGSHPDKLPHEERKSSINEDLLKTPPL-HRKIPKGVRKFCKWVA


Parental protein
TFGSSNIDEEFILKQFDIDCQSKPSHDVS--PPTNQAPPELKKRAGLKKLQEPPF-FQKPDYEQKLQKPQNPHKPKCVKMRYGAWYLNTKLWKKQRADEP
TFG...IDEEFI.KQFDI....KP..D.S.....N..P..LK.R.G..K.....F.......E.KLQKP.NP.KP..VK.RYGAWYL..KLWKK...DEP
Retrocopy
TFGDLGIDEEFIMKQFDIGYECKPTYDRSHTKKVNHVPLDLKYRKGRDKMDDIKFSIYWENWERKLQKPKNPYKPNWVKVRYGAWYLKPKLWKKLINDEP


Parental protein
LVDPKVSCKAQDENFKREMQEQESLADLHGTTAFKDFVLSRGYRMPSFLAKMYVRKERKCECNKTSI
L.DPKV...A.D....R.......L..L.GT.AFKDF.LS.GYRMP.FL.K...RK..K.....T.I
Retrocopy
LIDPKVLHEAPDGRYGRNFPQKDILEELYGTIAFKDFILSKGYRMPGFLEKLFLRKGWKYDSVRTPI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide