RetrogeneDB ID:
retro_mputfur_1000
Organism:
Location:
GL896989.1:5167970-5168573 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.28 %
Coverage:
82.04 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
YWHAZ
Parental gene aliases:
No gene alias available
Parental gene description:
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:HGNC Symbol;Acc:12855]

Genomic region (view in browser)





>retro_mputfur_1000
GATAAAAATGAGCTGGTGCAGAGGGCCAAACTGGCCAAGCAGGCTGAGCGATATGAAGAC
ATGGCAGCGTGCATGGAGTCTGTAACTGAGCAAGGAGCTGAATTATCTGATGAGTAGAGG
AATCTTCTCACAGTTGCTTATAAAAATGCTGTAGGAGCCCATAGGTCATCTTGGAGGGTT
GTCTCAAGTATTGAGCAAAAGACGGAAGGTGCTGAGAAAAAACAGCAGATGGCTTGAGAA
TACGGTGAGAAAATTGAGACTGAGCCAAGAGATGTCTACAATGATGTACTGTCTTTTTTG
GAAAAGTGTTTGATCCCCAATGCTTCACAAGCAGAGAGCAAAGTCTTCTATTTGAAAATG
AAAGGAGACTACTACAGTTACCTAGCCAAGGTTGCTGCTGGTGATGACAAGAAAGGTACT
GTAGATCACTCACAACAAGCATTACCAAGAAGCTTTTGAAATCAGCCAAAAGGAAATGCA
ACCAACACATCCTACCAGATTGGGTCTGGCCCTTAACTTCTCTGTGTTCTATGATGAAAT
TCTGACCTCCTGGAGAAGGTCGCTTTCTTGCAAAGACAGCACGCTAATAATGCAATTACT
GAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLL
DKNELVQ.AKLA.QAERY.DMAACM.SVTEQGAELS.E.RNLL.VAYKN.VGA.RSSWRVVSSIEQKTEGAEKKQQMA.EY.EKIETE.RD..NDVLS.L
Retrocopy
DKNELVQRAKLAKQAERYEDMAACMESVTEQGAELSDE*RNLLTVAYKNAVGAHRSSWRVVSSIEQKTEGAEKKQQMA*EYGEKIETEPRDVYNDVLSFL


Parental protein
EKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQA-YQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNS-PEKACSLAKTAFDEA
EK.LIPNASQAESKVFYLKMKGDYY.YLA.VAAGDDKKG.VD.SQQA.YQEAFEIS.KEMQPTHP.RLGLALNFSVFY.EIL.S..EK...L.......A
Retrocopy
EKCLIPNASQAESKVFYLKMKGDYYSYLAKVAAGDDKKGTVDHSQQA\YQEAFEISQKEMQPTHPTRLGLALNFSVFYDEILTS/LEKVAFLQRQHANNA


Parental protein
IAE
I.E
Retrocopy
ITE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide