RetrogeneDB ID:
retro_mputfur_1002
Organism:
Location:
GL896992.1:3610461-3610894 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.83 %
Coverage:
73.23 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
FCF1
Parental gene aliases:
No gene alias available
Parental gene description:
FCF1 rRNA-processing protein [Source:HGNC Symbol;Acc:20220]

Genomic region (view in browser)





>retro_mputfur_1002
AAAGAAAGAAAATATCCCAGTGCACTCAAAGAAAGAGAAGACCCCCAACATCCTTCCTGT
TTACTCTTCCAAGATAACACACAGCTGGACCCACCTTAACACATCCTAACAGAAACCAAC
TTTATCAACTTTTCCATTCAGGCCAGGCTTGACTTAGTACAGTTAATGATGGACTATCTG
TTTGCCAAGTGTATCCCTTGAATAACAGACTTCACAATGGTTAAAATTGAGGAATTGGAG
CAAAAGTATCCAGTGGCCCTAAGGATTGCCAAAGACCCAAGATTTGAACGATGACCAAGC
CACACAAAGGAACCTATGCAGATGACAGCTTAGTACAGAGAGTAACTCAACACAAGTGTT
ATACTTGGCCACAACTAGCCTGGATCTTAAAAGAAGGATGGGGAAGATCCCTAGAGTTCC
CATAATATATATC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAKDPRFERLPC
KE.K.PSALKERE.PQHPSCL.FQ.NTQL.PP.HIL..TNFINFSI.A.LDLVQ.MMD.L.AKCIP.ITD..M..IE.L.QKY.VALRIAKDPRFER.P.
Retrocopy
KERKYPSALKEREDPQHPSCLLFQDNTQLDPP*HILTETNFINFSIQARLDLVQLMMDYLFAKCIP*ITDFTMVKIEELEQKYPVALRIAKDPRFER*PS


Parental protein
-THKGTYADDCLVQRVTQHKCY-IVATVDRDLKRRIRKIPGVPIMYI
..HKGTYADD.LVQRVTQHKCY...AT...DLKRR..KIP.VPI.YI
Retrocopy
/PHKGTYADDSLVQRVTQHKCY/YLATTSLDLKRRMGKIPRVPIIYI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide